KCNK17 Antibody - BSA Free

Immunohistochemistry-Paraffin: KCNK17 Antibody [NBP1-92041] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.

Analysis in control (vector only transfected HEK293T lysate) and KCNK17 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

KCNK17 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit KCNK17 Antibody - BSA Free (NBP1-92041) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: CSCCHHSSKEDFKSQSWRQGPDREPESHSPQQGCYPEGPMGIIQHLEPSAHAAGCGKDS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCNK17
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  KCNK17 Protein (NBP1-92041PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for KCNK17 Antibody - BSA Free

• Acid-sensitive potassium channel protein TASK-4
• K2p17.1
• potassium channel subfamily K member 17
• potassium channel, subfamily K, member 17
• TALK22P domain potassium channel Talk-2
• TALK-2TWIK-related alkaline pH-activated K(+) channel 2
• TASK-4
• TASK4TWIK-related acid-sensitive K(+) channel 4

Background

The protein encoded by the KCNK17 gene belongs to the family of potassium channel proteins containing two pore-forming Pdomains. This channel is an open rectifier which primarily passes outward current under physiological K+concentrations. This gene is activated at alkaline pH. Alternatively spliced transcript variants encoding differentisoforms have been found for this gene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCNK17