KCNK3 Antibody - BSA Free

Western Blot: KCNK3 Antibody [NBP2-84108] - Host: Mouse. Target Name: KCNK3. Sample Tissue: Mouse Kidney. Antibody Dilution: 1ug/ml

Western Blot: KCNK3 Antibody [NBP2-84108] - WB Suggested Anti-KCNK3 Antibody Titration: 1.25ug/ml. ELISA Titer: 1:1562500. Positive Control: Jurkat cell lysate

Western Blot: KCNK3 Antibody [NBP2-84108] - Host: Rabbit. Target: KCNK3. Positive control (+): Hela (HL). Negative control (-): Liver tumor (T-LI). Antibody concentration: 3ug/ml

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

KCNK3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit KCNK3 Antibody - BSA Free (NBP2-84108) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human KCNK3. Peptide sequence: TCVEQSHSSPGGGGRYSDTPSRRCLCSGAPRSAISSVSTGLHSLSTFRGL The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCNK3
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for KCNK3 Antibody - BSA Free

• Acid-sensitive potassium channel protein TASK-1
• cardiac potassium channel
• K2p3.1
• KCNK3
• OAT1
• potassium channel subfamily K member 3
• potassium channel, subfamily K, member 3
• potassium inwardly-rectifying channel, subfamily K, member 3
• TASK
• TASK1
• TASK-1
• TASKacid-sensitive potassium channel protein TASK
• TBAK1
• TWIK-related acid-sensitive K(+) channel 1
• TWIK-related acid-sensitive K+ channel
• two P domain potassium channel
• Two pore K(+) channel KT3.1
• Two pore potassium channel KT3.1

Background

The KCNK3 gene encodes a member of the superfamily of potassium channel proteins that contain two pore-forming P domains. The encoded protein is an outwardly rectifying channel that is sensitive to changes in extracellular pH and is inhibited by extracellular

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCNK3