KCNK10 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: KCNK10 Antibody [NBP1-81571] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli, cytoplasm & centrosome.
Immunohistochemistry-Paraffin: KCNK10 Antibody [NBP1-81571] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mouse, RatSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

KCNK10 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RSVFAALDTGRFKASSQESINNRPNNLRLKGPEQLNKHGQGASEDNIINKFGSTSRLTKRKNKDLKKTLPEDVQKIYKTFRNYSLDEEKKEEETEKMCNSDNSSTA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KCNK10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
KCNK10 Protein (NBP1-81571PEP)

Alternate Names for KCNK10 Antibody

  • 2P domain potassium channel TREK2
  • K2p10.1
  • Outward rectifying potassium channel protein TREK-2
  • potassium channel subfamily K member 10
  • potassium channel TREK-2
  • potassium channel, subfamily K, member 10
  • TREK-2 K(+) channel subunit
  • TREK-2
  • TREK2FLJ43399
  • TWIK-related K+ channel 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-41535
Species: Hu, Mu, Bv
Applications: ICC/IF (-), IHC (-), WB
NBP1-69621
Species: Hu
Applications: WB
NBP2-42202
Species: Rt
Applications: WB, ICC/IF, IHC, ICC
NBP2-32432
Species: Hu
Applications: IHC, IHC-P
NBP1-77097
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-84987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34063
Species: Hu
Applications: IHC, IHC-P
NBP1-80271
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-41132
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-34340
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-84168
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-80084
Species: Hu
Applications: WB
FAB1225A
Species: Hu
Applications: Flow
NBP1-61399
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-58906
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1617
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for KCNK10 Antibody (NBP1-81571) (0)

There are no publications for KCNK10 Antibody (NBP1-81571).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KCNK10 Antibody (NBP1-81571) (0)

There are no reviews for KCNK10 Antibody (NBP1-81571). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for KCNK10 Antibody (NBP1-81571) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KCNK10 Antibody Products

Related Products by Gene

Bioinformatics Tool for KCNK10 Antibody (NBP1-81571)

Discover related pathways, diseases and genes to KCNK10 Antibody (NBP1-81571). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KCNK10 Antibody (NBP1-81571)

Discover more about diseases related to KCNK10 Antibody (NBP1-81571).
 

Pathways for KCNK10 Antibody (NBP1-81571)

View related products by pathway.

PTMs for KCNK10 Antibody (NBP1-81571)

Learn more about PTMs related to KCNK10 Antibody (NBP1-81571).

Blogs on KCNK10

There are no specific blogs for KCNK10, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol KCNK10

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-81571 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought