KCNK10 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: KCNK10 Antibody [NBP1-81571] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli, cytoplasm and centrosome.
Immunohistochemistry-Paraffin: KCNK10 Antibody [NBP1-81571] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

KCNK10 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RSVFAALDTGRFKASSQESINNRPNNLRLKGPEQLNKHGQGASEDNIINKFGSTSRLTKRKNKDLKKTLPEDVQKIYKTFRNYSLDEEKKEEETEKMCNSDNSSTA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KCNK10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
KCNK10 Protein (NBP1-81571PEP)

Alternate Names for KCNK10 Antibody

  • 2P domain potassium channel TREK2
  • K2p10.1
  • Outward rectifying potassium channel protein TREK-2
  • potassium channel subfamily K member 10
  • potassium channel TREK-2
  • potassium channel, subfamily K, member 10
  • TREK-2 K(+) channel subunit
  • TREK-2
  • TREK2FLJ43399
  • TWIK-related K+ channel 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-41535
Species: Hu, Mu, Bv
Applications: ICC/IF (-), IHC (-), WB
NBP1-69621
Species: Hu
Applications: WB
NBP2-42202
Species: Rt
Applications: WB, ICC/IF, IHC, ICC
H00051305-R01
Species: Hu
NBP2-32432
Species: Hu
Applications: IHC, IHC-P
NBP1-77097
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-84987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34063
Species: Hu
Applications: IHC, IHC-P
NBP1-80271
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-41132
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-34340
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-80084
Species: Hu
Applications: WB
NBP1-61399
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-58906
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1617
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-81571
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for KCNK10 Antibody (NBP1-81571) (0)

There are no publications for KCNK10 Antibody (NBP1-81571).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KCNK10 Antibody (NBP1-81571) (0)

There are no reviews for KCNK10 Antibody (NBP1-81571). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for KCNK10 Antibody (NBP1-81571) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KCNK10 Antibody Products

Related Products by Gene

Bioinformatics Tool for KCNK10 Antibody (NBP1-81571)

Discover related pathways, diseases and genes to KCNK10 Antibody (NBP1-81571). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KCNK10 Antibody (NBP1-81571)

Discover more about diseases related to KCNK10 Antibody (NBP1-81571).
 

Pathways for KCNK10 Antibody (NBP1-81571)

View related products by pathway.

PTMs for KCNK10 Antibody (NBP1-81571)

Learn more about PTMs related to KCNK10 Antibody (NBP1-81571).

Blogs on KCNK10

There are no specific blogs for KCNK10, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our KCNK10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNK10

Customers Who Bought This Also Bought