KCNE1 Antibody (2A6) Summary
Immunogen |
KCNE1 (AAH36452, 1 a.a. ~ 105 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MILSNTTAVTPFLTKLWQETVQQGGNMSGLAHRSPRSGDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRS |
Specificity |
KCNE1 (2A6) |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
KCNE1 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunoprecipitation
|
Application Notes |
Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
Quality control test: Antibody Reactive Against Recombinant Protein.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for KCNE1 Antibody (2A6)
Background
The product of this gene belongs to the potassium channel KCNE family. Potassium ion channels are essential to many cellular functions and show a high degree of diversity, varying in their electrophysiologic and pharmacologic properties. This gene encodes a transmembrane protein known to associate with the product of the KVLQT1 gene to form the delayed rectifier potassium channel. Mutation in this gene are associated with both Jervell and Lange-Nielsen and Romano-Ward forms of long-QT syndrome. Alternatively spliced transcript variants encoding the same protein have been identified.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IP, RIA, WB
Species: Av, Bv, Sh
Applications: WB
Species: Bv, Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, MiAr, Simple Western, WB
Species: Hu
Applications: ELISA, IP
Publications for KCNE1 Antibody (H00003753-M13) (0)
There are no publications for KCNE1 Antibody (H00003753-M13).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for KCNE1 Antibody (H00003753-M13) (0)
There are no reviews for KCNE1 Antibody (H00003753-M13).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for KCNE1 Antibody (H00003753-M13) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional KCNE1 Products
Bioinformatics Tool for KCNE1 Antibody (H00003753-M13)
Discover related pathways, diseases and genes to KCNE1 Antibody (H00003753-M13). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for KCNE1 Antibody (H00003753-M13)
Discover more about diseases related to KCNE1 Antibody (H00003753-M13).
| | Pathways for KCNE1 Antibody (H00003753-M13)
View related products by pathway.
|
PTMs for KCNE1 Antibody (H00003753-M13)
Learn more about PTMs related to KCNE1 Antibody (H00003753-M13).
| | Research Areas for KCNE1 Antibody (H00003753-M13)
Find related products by research area.
|
Blogs on KCNE1