KCNE1 Antibody (2A6)

Images

 
ELISA: KCNE1 Antibody (2A6) [H00003753-M13] - Detection limit for recombinant GST tagged KCNE1 is approximately 3ng/ml as a capture antibody.
Immunoprecipitation: KCNE1 Antibody (2A6) [H00003753-M13] - Analysis of KCNE1 transfected lysate using anti-KCNE1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with KCNE1 rabbit polyclonal antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, IP
Clone
2A6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

KCNE1 Antibody (2A6) Summary

Immunogen
KCNE1 (AAH36452, 1 a.a. - 105 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MILSNTTAVTPFLTKLWQETVQQGGNMSGLAHRSPRSGDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRS
Specificity
KCNE1 (2A6)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
KCNE1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoprecipitation
Application Notes
Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for KCNE1 Antibody (2A6)

  • Delayed rectifier potassium channel subunit IsK
  • FLJ18426
  • FLJ38123
  • IKs producing slow voltage-gated potassium channel subunit beta Mink
  • ISK
  • Isk-related subfamily, member 1
  • JLNS2FLJ94103
  • LQT2/5
  • MGC33114
  • Minimal potassium channel
  • MinK
  • potassium voltage-gated channel, Isk-related family, member 1
  • voltage gated potassiun channel accessory subunit

Background

The product of this gene belongs to the potassium channel KCNE family. Potassium ion channels are essential to many cellular functions and show a high degree of diversity, varying in their electrophysiologic and pharmacologic properties. This gene encodes a transmembrane protein known to associate with the product of the KVLQT1 gene to form the delayed rectifier potassium channel. Mutation in this gene are associated with both Jervell and Lange-Nielsen and Romano-Ward forms of long-QT syndrome. Alternatively spliced transcript variants encoding the same protein have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBL1-12154
Species: Hu
NBP1-84730
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38146
Species: Hu
Applications: IHC, IHC-P
NB110-61010
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, RIA, CyTOF-ready
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NBP1-83238
Species: Hu
Applications: IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-12155
Species: Hu
NBP2-19315
Species: Hu
Applications: WB
NBP2-33891
Species: Hu
Applications: IHC, IHC-P
NBP2-12900
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for KCNE1 Antibody (H00003753-M13) (0)

There are no publications for KCNE1 Antibody (H00003753-M13).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KCNE1 Antibody (H00003753-M13) (0)

There are no reviews for KCNE1 Antibody (H00003753-M13). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for KCNE1 Antibody (H00003753-M13) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KCNE1 Products

Bioinformatics Tool for KCNE1 Antibody (H00003753-M13)

Discover related pathways, diseases and genes to KCNE1 Antibody (H00003753-M13). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KCNE1 Antibody (H00003753-M13)

Discover more about diseases related to KCNE1 Antibody (H00003753-M13).
 

Pathways for KCNE1 Antibody (H00003753-M13)

View related products by pathway.

PTMs for KCNE1 Antibody (H00003753-M13)

Learn more about PTMs related to KCNE1 Antibody (H00003753-M13).

Blogs on KCNE1

There are no specific blogs for KCNE1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KCNE1 Antibody (2A6) and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNE1
Entrez
OMIM
Uniprot