KCC2/SLC12A5 Antibody - BSA Free

Western Blot: KCC2/SLC12A5 Antibody [NBP1-74063] - Mouse Brain Lysate 1ug/ml Gel Concentration 6-18%

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

KCC2/SLC12A5 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to the N terminal of Slc12a5. Immunizing peptide sequence TDCEDGDGGANPGDGNPKESSPFINSTDTEKGREYDGRNMALFEEEMDTS. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC12A5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for KCC2/SLC12A5 Antibody - BSA Free

• Electroneutral potassium-chloride cotransporter 2
• hKCC2
• KCC2
• KCC2K-Cl cotransporter 2
• KIAA1176erythroid K-Cl cotransporter 2
• Neuronal K-Cl cotransporter
• SLC12A5
• solute carrier family 12 (potassium/chloride transporter), member 5
• solute carrier family 12 member 5

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC12A5