KCC2/SLC12A5 Antibody

Images

 
Western Blot: KCC2/SLC12A5 Antibody [NBP1-74063] - Mouse Brain Lysate 1ug/ml Gel Concentration 6-18%

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KCC2/SLC12A5 Antibody Summary

Immunogen
Synthetic peptides corresponding to the N terminal of Slc12a5. Immunizing peptide sequence TDCEDGDGGANPGDGNPKESSPFINSTDTEKGREYDGRNMALFEEEMDTS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC12A5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Slc12a5 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for KCC2/SLC12A5 Antibody

  • Electroneutral potassium-chloride cotransporter 2
  • hKCC2
  • KCC2
  • KCC2K-Cl cotransporter 2
  • KIAA1176erythroid K-Cl cotransporter 2
  • Neuronal K-Cl cotransporter
  • SLC12A5
  • solute carrier family 12 (potassium/chloride transporter), member 5
  • solute carrier family 12 member 5

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB8528
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-83067
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP1-89282
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85133
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF2086
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
AF2180
Species: Hu
Applications: WB, Simple Western, IP
NBP1-57622
Species: Hu
Applications: WB, IHC, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP1-33284
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-46628
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
AF2185
Species: Hu, Mu, Rt
Applications: WB, IP
NBP1-59448
Species: Hu
Applications: WB
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P

Publications for KCC2/SLC12A5 Antibody (NBP1-74063) (0)

There are no publications for KCC2/SLC12A5 Antibody (NBP1-74063).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KCC2/SLC12A5 Antibody (NBP1-74063) (0)

There are no reviews for KCC2/SLC12A5 Antibody (NBP1-74063). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KCC2/SLC12A5 Antibody (NBP1-74063) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KCC2/SLC12A5 Products

Bioinformatics Tool for KCC2/SLC12A5 Antibody (NBP1-74063)

Discover related pathways, diseases and genes to KCC2/SLC12A5 Antibody (NBP1-74063). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KCC2/SLC12A5 Antibody (NBP1-74063)

Discover more about diseases related to KCC2/SLC12A5 Antibody (NBP1-74063).
 

Pathways for KCC2/SLC12A5 Antibody (NBP1-74063)

View related products by pathway.

PTMs for KCC2/SLC12A5 Antibody (NBP1-74063)

Learn more about PTMs related to KCC2/SLC12A5 Antibody (NBP1-74063).

Blogs on KCC2/SLC12A5

There are no specific blogs for KCC2/SLC12A5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KCC2/SLC12A5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC12A5
Entrez