katanin-p80 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: katanin-p80 Antibody [NBP1-87413] - Katanin p60 and p80 expression in the mouse testis. Immunohistochemical localization of katanin p60 (right) and p80 (left) in the mouse seminiferous epithelium. Katanin subunits?=?red, alpha-tubulin?=?green, nuclei?=?blue. Both katanin subunits were prominently localized to elongating spermatids (arrowheads). Katanin p60 was also visible in Sertoli cell nuclei (SC). The inset in each micrograph shows a control for the secondary antibody (primary antibody substituted with buffer). Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pgen.1002698), licensed under a CC-BY license.

Immunohistochemistry-Paraffin: katanin-p80 Antibody [NBP1-87413] - Staining in human testis and pancreas tissues using anti-KATNB1 antibody. Corresponding KATNB1 RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: katanin-p80 Antibody [NBP1-87413] - Staining of human cell line U-2 OS shows localization to plasma membrane, cytosol and microtubules.

Western Blot: katanin-p80 Antibody [NBP1-87413] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunohistochemistry-Paraffin: katanin-p80 Antibody [NBP1-87413] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: katanin-p80 Antibody [NBP1-87413] - Staining of human testis shows high expression.

• Reactivity: Hu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

katanin-p80 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SPAMDVQFPVPNLEVLPRPPVVASTPAPKAEPAIIPATRNEPIGLKASDFLPAVKIPQQAELVDEDAMSQIRKGHDTMCVVLTSRHKNLDTVRAVWTMGDIKTSVDSAVAINDLSVV
• Predicted Species: Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KATNB1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  katanin-p80 Protein (NBP1-87413PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for katanin-p80 Antibody - BSA Free

• KAT
• katanin (80 kDa)
• katanin p80 (WD repeat containing) subunit B 1
• katanin p80 (WD40-containing) subunit B 1
• Katanin p80 subunit B1
• katanin p80 WD40-containing subunit B1
• p80 katanin

Background

Microtubules, polymers of alpha and beta tubulin subunits, form the mitotic spindle of a dividing cell and help toorganize membranous organelles during interphase. Katanin is a heterodimer that consists of a 60 kDa ATPase (p60subunit A 1) and an 80 kDa accessory protein (p80 subunit B 1). The p60 subunit acts to sever and disassemblemicrotubules, while the p80 subunit targets the enzyme to the centrosome. Katanin is a member of the AAA family ofATPases. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for katanin-p80 Antibody (NBP1-87413)(1)

Publication using NBP1-87413

• O'Donnell L, Rhodes D, Smith SJ et al. An essential role for katanin p80 and microtubule severing in male gamete production. PLoS Genet 2012-01-01 [PMID: 22654669]

Bioinformatics

• Gene Symbol: KATNB1
• Entrez:
  • 10300(Human)
• Uniprot:
  • Q9BVA0(Human)