KAT4/TBP Associated Factor 1 Antibody (1E11.)

Images

 
Sandwich ELISA: KAT4/TBP Associated Factor 1 Antibody (1E11) [H00006872-M01] - Detection limit for recombinant GST tagged TAF1 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1E11.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

KAT4/TBP Associated Factor 1 Antibody (1E11.) Summary

Immunogen
TAF1 (NP_004597 1784 a.a. - 1893 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RMLQENTRMDMENEESMMSYEGDGGEASHGLEDSNISYGSYEEPDPKSNTQDTSFSSIGGYEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFHSIAGDSDLDSDE
Specificity
TAF1 - TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 250kDa
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TAF1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for KAT4/TBP Associated Factor 1 Antibody (1E11.)

  • 250kDa
  • BA2Rdystonia 3 (with Parkinsonism)
  • CCG1TATA box binding protein (TBP)-associated factor, RNA polymerase II, A, 250kD
  • CCGS
  • Cell cycle gene 1 protein
  • cell cycle, G1 phase defect
  • complementation of cell cycle block, G1-to-S
  • DYT3/TAF1
  • EC 2.7.11
  • EC 2.7.11.1
  • KAT4
  • NSCL2
  • OF
  • P250
  • TAF(II)250
  • TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor
  • TAF2AN-TAF1
  • TAFII-250
  • TAFII250DYT3
  • TBP-associated factor 250 kDa
  • transcription factor TFIID p250 polypeptide
  • Transcription initiation factor TFIID 250 kDa subunit
  • transcription initiation factor TFIID subunit 1
  • XDP

Background

Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is the basal transcription factor TFIID, which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes the largest subunit of TFIID. This subunit binds to core promoter sequences encompassing the transcription start site. It also binds to activators and other transcriptional regulators, and these interactions affect the rate of transcription initiation. This subunit contains two independent protein kinase domains at the N and C-terminals, but also possesses acetyltransferase activity and can act as a ubiquitin-activating/conjugating enzyme. Two transcripts encoding different isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP2-38188
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1334
Species: Hu
Applications: WB, IHC
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NBP2-17017
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-80705
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-01265
Species: Hu, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00008850-M04
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
H00006879-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA

Publications for KAT4/TBP Associated Factor 1 Antibody (H00006872-M01) (0)

There are no publications for KAT4/TBP Associated Factor 1 Antibody (H00006872-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KAT4/TBP Associated Factor 1 Antibody (H00006872-M01) (0)

There are no reviews for KAT4/TBP Associated Factor 1 Antibody (H00006872-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KAT4/TBP Associated Factor 1 Antibody (H00006872-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KAT4/TBP Associated Factor 1 Products

Bioinformatics Tool for KAT4/TBP Associated Factor 1 Antibody (H00006872-M01)

Discover related pathways, diseases and genes to KAT4/TBP Associated Factor 1 Antibody (H00006872-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KAT4/TBP Associated Factor 1 Antibody (H00006872-M01)

Discover more about diseases related to KAT4/TBP Associated Factor 1 Antibody (H00006872-M01).
 

Pathways for KAT4/TBP Associated Factor 1 Antibody (H00006872-M01)

View related products by pathway.

PTMs for KAT4/TBP Associated Factor 1 Antibody (H00006872-M01)

Learn more about PTMs related to KAT4/TBP Associated Factor 1 Antibody (H00006872-M01).

Blogs on KAT4/TBP Associated Factor 1

There are no specific blogs for KAT4/TBP Associated Factor 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KAT4/TBP Associated Factor 1 Antibody (1E11.) and receive a gift card or discount.

Bioinformatics

Gene Symbol TAF1
Entrez
OMIM
Uniprot