KAT3B/p300 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EP300. Source: E. coli
Amino Acid Sequence: TQSTGMMNSPVNQPAMGMNTGMNAGMNPGMLAAGNGQGIMPNQVMNGSIGAGRGRQNMQYPNPGMGSAGNLLTEPLQQGSPQMGGQTGLRGPQPLKMGMMNNPNPYGSPYTQNPGQQ Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
EP300 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87693. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
30 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for KAT3B/p300 Recombinant Protein Antigen
Background
p300 is a relatively stable and ubiquitously expressed nuclear phosphoprotein which is conserved among a variety of mammalian species. It is actively synthesized and phosphorylated in both quiescent and proliferating cells. Cyclic AMP-responsive enhancer binding protein (CREB) binding protein (CBP) and p300 are closely related transcriptional coactivators and have been shown to directly interact with many different DNA-binding transcription factors including nuclear hormone receptors, CREB, c-Fos, C-Jun/v-Jun, c-Myb/v-Myb, TFIIB and MyoD. Both CBP and p300 have been shown to display histone acetyltransferase (HAT) activity, capable of acetylating all four core histone particles in nucleosomes. As a result of HAT activity, it has been suggested CBP and p300 may play a direct role in activating chromatin for transcription.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Am, Av, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu
Applications: EnzAct
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
Publications for KAT3B/p300 Protein (NBP1-87693PEP)(1)
Showing Publication 1 -
1 of 1.
Reviews for KAT3B/p300 Protein (NBP1-87693PEP) (0)
There are no reviews for KAT3B/p300 Protein (NBP1-87693PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for KAT3B/p300 Protein (NBP1-87693PEP) (0)
Additional KAT3B/p300 Products
Research Areas for KAT3B/p300 Protein (NBP1-87693PEP)
Find related products by research area.
|
Blogs on KAT3B/p300