Kallikrein 15 Recombinant Protein Antigen

Images

 
There are currently no images for Kallikrein 15 Protein (NBP1-90265PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Kallikrein 15 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KLK15.

Source: E.coli

Amino Acid Sequence: QDGDKLLEGDECAPHSQPWQVALYERGRFNCGASLISPHWVLSAAHCQSRFMRVRLGEHNLRKRDGPEQLRTTS

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KLK15
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-90265.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Kallikrein 15 Recombinant Protein Antigen

  • ACO protease
  • ACO
  • EC 3.4.21
  • EC 3.4.21.-
  • EC 3.4.21.4
  • HSRNASPH
  • Kallikrein 15
  • kallikrein-15
  • kallikrein-like serine protease
  • kallikrein-related peptidase 15
  • KLK15
  • Prostinogen

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-92088
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP1-90260
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90276
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB2337
Species: Hu
Applications: WB, IP
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF6898
Species: Hu, Mu, Rt
Applications: WB
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87677
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
AF2008
Species: Hu
Applications: WB, IHC, IP
NB100-53791
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-90265PEP
Species: Hu
Applications: AC

Publications for Kallikrein 15 Protein (NBP1-90265PEP) (0)

There are no publications for Kallikrein 15 Protein (NBP1-90265PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kallikrein 15 Protein (NBP1-90265PEP) (0)

There are no reviews for Kallikrein 15 Protein (NBP1-90265PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for Kallikrein 15 Protein (NBP1-90265PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Kallikrein 15 Products

Bioinformatics Tool for Kallikrein 15 Protein (NBP1-90265PEP)

Discover related pathways, diseases and genes to Kallikrein 15 Protein (NBP1-90265PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kallikrein 15 Protein (NBP1-90265PEP)

Discover more about diseases related to Kallikrein 15 Protein (NBP1-90265PEP).
 

Pathways for Kallikrein 15 Protein (NBP1-90265PEP)

View related products by pathway.

PTMs for Kallikrein 15 Protein (NBP1-90265PEP)

Learn more about PTMs related to Kallikrein 15 Protein (NBP1-90265PEP).
 

Research Areas for Kallikrein 15 Protein (NBP1-90265PEP)

Find related products by research area.

Blogs on Kallikrein 15

There are no specific blogs for Kallikrein 15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Kallikrein 15 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KLK15
Entrez