KA2/GRIK5/Glutamate Receptor KA2 Recombinant Protein Antigen Summary
Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KA2/GRIK5/Glutamate Receptor KA2. Source: E. coli
Amino Acid Sequence: KVSTIIIDANASISHLILRKASELGMTSAFYKYILTTMDFPILHLDGIVEDSSNILGFSMFNTSHPFYPEFVRSLNMSWRENCEASTY Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
Source |
E. coli |
Protein/Peptide Type |
Recombinant Protein Antigen |
Gene |
GRIK5 |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Dilutions |
- Antibody Competition 10-100 molar excess
|
Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68975. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
Theoretical MW |
28 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 1M Urea, pH 7.4. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for KA2/GRIK5/Glutamate Receptor KA2 Recombinant Protein Antigen
Background
Glutamate receptor KA2 is a protein that interacts with glutamate, an excitatory neurotransmitter, in the central nervous system and that has two isoforms, measuring 980 and 981 amino acids in length, with weights of approximately 109 and 110 kDa respectively. Current studies are being done on diseases and disorders related to this protein including temporal lobe epilepsy, embryonal carcinoma, Parkinson's disease, schizophrenia, retinoblastoma, neruoblastoma, thyroiditis, and neuronitis. Glutamate receptor KA2 has also been shown to have interactions with GOLM1, GPAA1, LRSAM1, DLG4, and GRID2 in pathways such as the glutamic acid signaling, transmission across chemical synapses, and activation of kainite receptor pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Bt, Bv, Ca, Ha, Hu, Mu, Po, Rb, Rt
Applications: ICC, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Bv, Hu
Applications: ICC, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, WB
Species: Bv, Eq, Hu, Pm, Po, Pm
Applications: ICC, IHC, IHC-P, WB
Species: Hu, Mu, Rb, Rt
Applications: IHC, IHC-P, IP, KO, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, S-ELISA, WB
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
Species: Hu, Mu, Rt
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IP, Simple Western, WB
Publications for KA2/GRIK5/Glutamate Receptor KA2 Recombinant Protein Antigen (NBP2-68975PEP) (0)
There are no publications for KA2/GRIK5/Glutamate Receptor KA2 Recombinant Protein Antigen (NBP2-68975PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for KA2/GRIK5/Glutamate Receptor KA2 Recombinant Protein Antigen (NBP2-68975PEP) (0)
There are no reviews for KA2/GRIK5/Glutamate Receptor KA2 Recombinant Protein Antigen (NBP2-68975PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for KA2/GRIK5/Glutamate Receptor KA2 Recombinant Protein Antigen (NBP2-68975PEP) (0)
Additional KA2/GRIK5/Glutamate Receptor KA2 Products
Research Areas for KA2/GRIK5/Glutamate Receptor KA2 Recombinant Protein Antigen (NBP2-68975PEP)
Find related products by research area.
|
Blogs on KA2/GRIK5/Glutamate Receptor KA2