KA2/GRIK5/Glutamate Receptor KA2 Recombinant Protein Antigen

Images

 
There are currently no images for KA2/GRIK5/Glutamate Receptor KA2 Recombinant Protein Antigen (NBP2-68975PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

KA2/GRIK5/Glutamate Receptor KA2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KA2/GRIK5/Glutamate Receptor KA2.

Source: E. coli

Amino Acid Sequence: KVSTIIIDANASISHLILRKASELGMTSAFYKYILTTMDFPILHLDGIVEDSSNILGFSMFNTSHPFYPEFVRSLNMSWRENCEASTY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GRIK5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68975.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for KA2/GRIK5/Glutamate Receptor KA2 Recombinant Protein Antigen

  • EAA2
  • Excitatory amino acid receptor 2
  • GluK5
  • glutamate receptor KA2
  • Glutamate receptor KA-2
  • glutamate receptor, ionotropic kainate 5
  • glutamate receptor, ionotropic, kainate 5
  • GRIK2
  • GRIK5
  • KA2/GRIK5
  • KA2GRIK2

Background

Glutamate receptor KA2 is a protein that interacts with glutamate, an excitatory neurotransmitter, in the central nervous system and that has two isoforms, measuring 980 and 981 amino acids in length, with weights of approximately 109 and 110 kDa respectively. Current studies are being done on diseases and disorders related to this protein including temporal lobe epilepsy, embryonal carcinoma, Parkinson's disease, schizophrenia, retinoblastoma, neruoblastoma, thyroiditis, and neuronitis. Glutamate receptor KA2 has also been shown to have interactions with GOLM1, GPAA1, LRSAM1, DLG4, and GRID2 in pathways such as the glutamic acid signaling, transmission across chemical synapses, and activation of kainite receptor pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76851
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-76849
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-75510
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NLS892
Species: Bt, Bv, Ca, Ha, Hu, Mu, Po, Rb, Rt
Applications: ICC, IHC,  IHC-P, WB
NBP2-22399
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-61782
Species: Hu
Applications: ELISA, ICC/IF, WB
NB300-118
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NLS921
Species: Bv, Hu
Applications: ICC, IHC,  IHC-P, WB
NBP1-02312
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP3-17081
Species: Hu
Applications: IHC,  IHC-P
NBP1-88790
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB300-106
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, WB
NLS3208
Species: Bv, Eq, Hu, Pm, Po, Pm
Applications: ICC, IHC,  IHC-P, WB
NB300-105
Species: Hu, Mu, Rb, Rt
Applications: IHC,  IHC-P, IP, KO, WB
NBP2-16684
Species: Hu, Mu, Rt
Applications: EM, IHC,  IHC-P, WB
H00051144-M08
Species: Hu, Mu, Rt
Applications: ELISA, S-ELISA, WB
NB300-126
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
AF2185
Species: Hu, Mu, Rt
Applications: IP, WB
AF2086
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NB300-107
Species: Hu, Mu, Rt
Applications: IP, Simple Western, WB

Publications for KA2/GRIK5/Glutamate Receptor KA2 Recombinant Protein Antigen (NBP2-68975PEP) (0)

There are no publications for KA2/GRIK5/Glutamate Receptor KA2 Recombinant Protein Antigen (NBP2-68975PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KA2/GRIK5/Glutamate Receptor KA2 Recombinant Protein Antigen (NBP2-68975PEP) (0)

There are no reviews for KA2/GRIK5/Glutamate Receptor KA2 Recombinant Protein Antigen (NBP2-68975PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for KA2/GRIK5/Glutamate Receptor KA2 Recombinant Protein Antigen (NBP2-68975PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KA2/GRIK5/Glutamate Receptor KA2 Products

Research Areas for KA2/GRIK5/Glutamate Receptor KA2 Recombinant Protein Antigen (NBP2-68975PEP)

Find related products by research area.

Blogs on KA2/GRIK5/Glutamate Receptor KA2

There are no specific blogs for KA2/GRIK5/Glutamate Receptor KA2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our KA2/GRIK5/Glutamate Receptor KA2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GRIK5