Recombinant Human KA1/GRIK4/Glutamate Receptor KA1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human KA1/GRIK4/Glutamate Receptor KA1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-110 of Human GRIK4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SPHSLRIAAILDDPMECSRGERLSITLAKNRINRAPERLGKAKVEVDIFELLRDSEYETAETMCQILPKGVVAVLGPSSSPASSSIISNICGEKEVPHFKVAPEEFVKFQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
GRIK4
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human KA1/GRIK4/Glutamate Receptor KA1 Protein

  • EAA1
  • Excitatory amino acid receptor 1
  • GluK4
  • glutamate receptor KA1
  • Glutamate receptor KA-1
  • glutamate receptor, ionotropic kainate 4
  • glutamate receptor, ionotropic, kainate 4
  • GRIK4
  • KA1
  • KA1GRIK

Background

GRIK4 - glutamate receptor, ionotropic, kainate 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76853
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-91946
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-76849
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NLS921
Species: Hu, Bv
Applications: WB, IHC-P, ICC
NBP1-02312
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
PPS050
Species: Hu, Mu, Rt, Ch, Pm, Ze
Applications: WB
NB300-118
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP, IF
NB300-124
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
PPS007
Species: Hu, Mu, Rt, Ca, Ch
Applications: WB
H00051144-M08
Species: Hu
Applications: WB, ELISA
NBP2-37584
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-45856
Species: Hu
Applications: WB, IHC, IF
NLS3208
Species: Hu, Po, Bv, Eq, Mk, Pm
Applications: WB, IHC-P, ICC
NB300-106
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IP
AF2185
Species: Hu, Mu, Rt
Applications: WB, IP
NB300-105
Species: Hu, Mu, Rt, Rb
Applications: WB, IHC, IHC-P, IP
36340002
Species: Hu
Applications: WB, ELISA
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB300-107
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
H00002900-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for KA1/GRIK4/Glutamate Receptor KA1 Partial Recombinant Protein (H00002900-Q01) (0)

There are no publications for KA1/GRIK4/Glutamate Receptor KA1 Partial Recombinant Protein (H00002900-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KA1/GRIK4/Glutamate Receptor KA1 Partial Recombinant Protein (H00002900-Q01) (0)

There are no reviews for KA1/GRIK4/Glutamate Receptor KA1 Partial Recombinant Protein (H00002900-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KA1/GRIK4/Glutamate Receptor KA1 Partial Recombinant Protein (H00002900-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KA1/GRIK4/Glutamate Receptor KA1 Products

Bioinformatics Tool for KA1/GRIK4/Glutamate Receptor KA1 Partial Recombinant Protein (H00002900-Q01)

Discover related pathways, diseases and genes to KA1/GRIK4/Glutamate Receptor KA1 Partial Recombinant Protein (H00002900-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KA1/GRIK4/Glutamate Receptor KA1 Partial Recombinant Protein (H00002900-Q01)

Discover more about diseases related to KA1/GRIK4/Glutamate Receptor KA1 Partial Recombinant Protein (H00002900-Q01).
 

Pathways for KA1/GRIK4/Glutamate Receptor KA1 Partial Recombinant Protein (H00002900-Q01)

View related products by pathway.

Research Areas for KA1/GRIK4/Glutamate Receptor KA1 Partial Recombinant Protein (H00002900-Q01)

Find related products by research area.

Blogs on KA1/GRIK4/Glutamate Receptor KA1

There are no specific blogs for KA1/GRIK4/Glutamate Receptor KA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

NMDAR2B Antibody
NB300-106-100ul

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human KA1/GRIK4/Glutamate Receptor KA1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GRIK4
Entrez