JWA Antibody - BSA Free

Western Blot: JWA Antibody [NBP1-84273] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-286

Immunohistochemistry-Paraffin: JWA Antibody [NBP1-84273] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Staining of human cell line U-251 MG shows localization to endoplasmic reticulum.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

JWA Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit JWA Antibody - BSA Free (NBP1-84273) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-JWA Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PLLLMFIHASLRLRNLKNKLENKMEGIGLKRTPMGIVLDALEQQEEGINRLTDYISKVKE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARL6IP5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  JWA Protein (NBP1-84273PEP)

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:33568779). Rat (85%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for JWA Antibody - BSA Free

• ADP-ribosylation factor-like protein 6-interacting protein 5
• ADP-ribosylation-like factor 6 interacting protein 5
• Aip-5
• ARL-6-interacting protein 5
• Cytoskeleton-related vitamin A-responsive protein
• Dermal papilla-derived protein 11
• DERP11addicsin
• Glutamate transporter EAAC1-interacting protein
• glutamate transporter EEAC1-associated protein
• GTRAP3-18aip-5
• hp22
• HSPC127
• JM5
• jmx
• JWAcytoskeleton related vitamin A responsive protein
• PRA1 domain family 3
• PRA1 family protein 3
• PRA2
• PRAF3dermal papilla derived protein 11
• Prenylated Rab acceptor protein 2
• Protein JWa
• putative MAPK activating protein PM27
• Putative MAPK-activating protein PM27

Background

The function of this protein is unknown but a similar protein in rats may play a role in the regulation of cell differentiation. The rat protein binds and inhibits the cell membrane glutamate transporter EAAC1. The expression of the rat gene is upregulated by retinoic acid, which results in a specific reduction in EAAC1-mediated glutamate transport.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for JWA Antibody (NBP1-84273)(1)

Publication using NBP1-84273

• Kinoshita C, Kikuchi-Utsumi K, Aoyama K et al. Inhibition of miR-96-5p in the mouse brain increases glutathione levels by altering NOVA1 expression Communications biology 2021-02-10 [PMID: 33568779] (WB, Mouse)

Bioinformatics

• Gene Symbol: ARL6IP5