Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MSEVRLPPLRALDDFVLGSARLAAPDPCDPQRWCHRVINN |
Predicted Species | Mouse (98%). Backed by our 100% Guarantee. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | PRAF2 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Publication using NBP1-87886 | Applications | Species |
---|---|---|
Koomoa DL, Go RC, Wester K et al. Expression profile of PRAF2 in the human brain and enrichment in synaptic vesicles. Neurosci Lett 2008-05-01 [PMID: 18395978] |
Secondary Antibodies |
Isotype Controls |
Diseases for JM4 Antibody (NBP1-87886)Discover more about diseases related to JM4 Antibody (NBP1-87886).
| Pathways for JM4 Antibody (NBP1-87886)View related products by pathway.
|
PTMs for JM4 Antibody (NBP1-87886)Learn more about PTMs related to JM4 Antibody (NBP1-87886).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | PRAF2 |