JM4 Antibody

Western Blot: JM4 Antibody [NBP1-87886] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunohistochemistry-Paraffin: JM4 Antibody [NBP1-87886] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Western Blot: JM4 Antibody [NBP1-87886] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells). Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla).

Immunohistochemistry-Paraffin: JM4 Antibody [NBP1-87886] - Analysis in human cerebral cortex and skeletal muscle tissues. Corresponding PRAF2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: JM4 Antibody [NBP1-87886] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: JM4 Antibody [NBP1-87886] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: JM4 Antibody [NBP1-87886] - Staining of human cerebellum shows moderate to strong cytoplasmic positivity in Purkinje cells.

• Reactivity: Hu, Rt, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

JM4 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MSEVRLPPLRALDDFVLGSARLAAPDPCDPQRWCHRVINN
• Predicted Species: Mouse (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRAF2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for JM4 Antibody

• FLJ57916
• Jena-Muenchen 4
• JM4
• PRA1 domain family 2
• PRA1 domain family, member 2
• PRA1 family protein 2

Background

JM4 is a four-transmembrane protein binding to the CCR5 receptor. It plays a role in the regulation of intracellular protein transport. It is expressed in normal brain, small intestine, lung, spleen and pancreas and has also been detected in tumors of the breast, colon, lung and ovary

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for JM4 Antibody (NBP1-87886)(1)

Publication using NBP1-87886

• Koomoa DL, Go RC, Wester K et al. Expression profile of PRAF2 in the human brain and enrichment in synaptic vesicles. Neurosci Lett 2008-05-01 [PMID: 18395978]

Bioinformatics

• Gene Symbol: PRAF2