JM4 Antibody


Western Blot: JM4 Antibody [NBP1-87886] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: JM4 Antibody [NBP1-87886] - Staining of human skeletal muscle shows low expression as expected.
Western Blot: JM4 Antibody [NBP1-87886] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells). Lane 3: PC12 cell lysate (Pheochromocytoma of rat more
Immunohistochemistry-Paraffin: JM4 Antibody [NBP1-87886] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
Immunohistochemistry-Paraffin: JM4 Antibody [NBP1-87886] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: JM4 Antibody [NBP1-87886] - Staining in human cerebral cortex and skeletal muscle tissues using anti-PRAF2 antibody. Corresponding PRAF2 RNA-seq data are presented for the same tissues.

Product Details

Reactivity Hu, Rt, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

JM4 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MSEVRLPPLRALDDFVLGSARLAAPDPCDPQRWCHRVINN
Specificity of human, rat JM4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (95%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Read Publication using NBP1-87886.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for JM4 Antibody

  • FLJ57916
  • Jena-Muenchen 4
  • JM4
  • PRA1 domain family 2
  • PRA1 domain family, member 2
  • PRA1 family protein 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
Species: Mu
Applications: WB, Block
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
Species: Hu, Mu, Rt, Rb
Applications: WB, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
Species: Hu, Rt, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for JM4 Antibody (NBP1-87886)(1)

Reviews for JM4 Antibody (NBP1-87886) (0)

There are no reviews for JM4 Antibody (NBP1-87886). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for JM4 Antibody (NBP1-87886) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional JM4 Products

Bioinformatics Tool for JM4 Antibody (NBP1-87886)

Discover related pathways, diseases and genes to JM4 Antibody (NBP1-87886). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for JM4 Antibody (NBP1-87886)

Discover more about diseases related to JM4 Antibody (NBP1-87886).

Pathways for JM4 Antibody (NBP1-87886)

View related products by pathway.

PTMs for JM4 Antibody (NBP1-87886)

Learn more about PTMs related to JM4 Antibody (NBP1-87886).

Blogs on JM4

There are no specific blogs for JM4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our JM4 Antibody and receive a gift card or discount.


Gene Symbol PRAF2