JMJD2D Recombinant Protein Antigen

Images

 
There are currently no images for JMJD2D Recombinant Protein Antigen (NBP2-49411PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

JMJD2D Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human JMJD2D.

Source: E. coli

Amino Acid Sequence: PLLAGTTCTASGPEPEPLPEDGALMDKPVPLSPGLQHPVKASGCSWAPV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KDM4D
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49411.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for JMJD2D Recombinant Protein Antigen

  • EC 1.14.11
  • EC 1.14.11.-
  • FLJ10251
  • JHDM3D
  • JmjC domain-containing histone demethylation protein 3D
  • JMJD2D
  • JMJD2Dlysine-specific demethylase 4D
  • jumonji domain containing 2D
  • Jumonji domain-containing protein 2D
  • KDM4D
  • lysine (K)-specific demethylase 4D
  • MGC141909

Background

JMJD2 is a member of the family of novel JmjC domain-containing histone demethylation (JHDM) enzymes, which has been shown to perform the enzymatic removal of methyl groups from histones. Histone demethylation by JHDM proteins requires cofactors Fe(II) and alpha-ketoglutarate. Family members include JHDM1 (demethylating histone 3 at lysine 36), and JHDM2A as well as JMJD2CH3K9 (both of which demethylate histone 3 at lysine 9). Histone demethylase activity has been linked to tumor development, decreases in cell proliferation, and hormone-dependent transcriptional activation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-40585
Species: Hu, Mu
Applications: ICC/IF, IP, WB
NBP1-49600
Species: Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NB100-55415
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NB100-74605
Species: Hu, Mu
Applications: IP, KD, WB
NBP2-46320
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
NB100-77282
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IP, KO, WB
NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
NBP2-27335
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
NBP2-49350
Species: Hu
Applications: IHC,  IHC-P, Simple Western, WB
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-46820
Species: Hu
Applications: ELISA, IHC, WB
PP-B0422-00
Species: Hu, Mu
Applications: DirELISA, IHC, IP, WB
NB200-322
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-43728
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
PP-N4111-00
Species: Hu
Applications: IHC, IP, WB
NBP2-49411PEP
Species: Hu
Applications: AC

Publications for JMJD2D Recombinant Protein Antigen (NBP2-49411PEP) (0)

There are no publications for JMJD2D Recombinant Protein Antigen (NBP2-49411PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for JMJD2D Recombinant Protein Antigen (NBP2-49411PEP) (0)

There are no reviews for JMJD2D Recombinant Protein Antigen (NBP2-49411PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for JMJD2D Recombinant Protein Antigen (NBP2-49411PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional JMJD2D Products

Research Areas for JMJD2D Recombinant Protein Antigen (NBP2-49411PEP)

Find related products by research area.

Blogs on JMJD2D

There are no specific blogs for JMJD2D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our JMJD2D Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KDM4D