JMJD1B Antibody


Immunocytochemistry/ Immunofluorescence: JMJD1B Antibody [NBP2-58143] - Staining of human cell line U-251 MG shows localization to nucleoplasm & the Golgi apparatus.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF

Order Details

JMJD1B Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TLSSSPTEERPTVGPGQQDNPLLKTFSNVFGRHSGGFLSSPADFSQENKAPFEAVKRFSLDERSLACRQDSDSST
Specificity of human JMJD1B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
JMJD1B Recombinant Protein Antigen (NBP2-58143PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for JMJD1B Antibody

  • C5orf7
  • EC 1.14.11
  • EC 1.14.11.-
  • JHDM2B
  • JmjC domain-containing histone demethylation protein 2B
  • JMJD1B
  • jumonji domain containing 1B
  • Jumonji domain-containing protein 1B
  • KIAA1082chromosome 5 open reading frame 7
  • lysine (K)-specific demethylase 3B
  • lysine-specific demethylase 3B
  • NET22,5qNCA
  • Nuclear protein 5qNCA


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC
Species: Hu, Mu
Applications: WB, IP
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for JMJD1B Antibody (NBP2-58143) (0)

There are no publications for JMJD1B Antibody (NBP2-58143).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for JMJD1B Antibody (NBP2-58143) (0)

There are no reviews for JMJD1B Antibody (NBP2-58143). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for JMJD1B Antibody (NBP2-58143) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for JMJD1B Antibody (NBP2-58143)

Discover related pathways, diseases and genes to JMJD1B Antibody (NBP2-58143). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for JMJD1B Antibody (NBP2-58143)

Discover more about diseases related to JMJD1B Antibody (NBP2-58143).

Pathways for JMJD1B Antibody (NBP2-58143)

View related products by pathway.

PTMs for JMJD1B Antibody (NBP2-58143)

Learn more about PTMs related to JMJD1B Antibody (NBP2-58143).

Blogs on JMJD1B

There are no specific blogs for JMJD1B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our JMJD1B Antibody and receive a gift card or discount.


Gene Symbol KDM3B