JAMP Antibody

Images

 
Immunohistochemistry: JAMP Antibody [NBP1-89906] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

JAMP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LYIRSCRVLMLSDWYTMLYNPSPDYVTTVHCTH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
JKAMP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10 - 1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
JAMP Protein (NBP1-89906PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for JAMP Antibody

  • C14orf100
  • chromosome 14 open reading frame 100
  • HSPC213
  • HSPC327
  • JAMPCDA06
  • JNK1/MAPK8-associated membrane protein
  • JNK1-associated membrane protein
  • JNK-associated membrane protein
  • Jun N-terminal kinase 1-associated membrane protein
  • Medulloblastoma antigen MU-MB-50.4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-88309
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-00990
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85310
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NB100-56357
Species: Hu
Applications: WB, IP
NB110-40591
Species: Hu
Applications: WB, IHC-P, IP
NBP1-88680
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57712
Species: Hu
Applications: ICC/IF
NBP1-31001
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-92271
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006045-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00009223-M03
Species: Hu, Rt, Ca, Ha
Applications: WB, ELISA, ICC/IF
MAB1846
Species: Hu, Mu, Rt
Applications: WB, ICC
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-89906
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for JAMP Antibody (NBP1-89906) (0)

There are no publications for JAMP Antibody (NBP1-89906).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for JAMP Antibody (NBP1-89906) (0)

There are no reviews for JAMP Antibody (NBP1-89906). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for JAMP Antibody (NBP1-89906) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional JAMP Products

Bioinformatics Tool for JAMP Antibody (NBP1-89906)

Discover related pathways, diseases and genes to JAMP Antibody (NBP1-89906). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on JAMP.

JAMP (JNK1/MAPK8 associated membrane protein)
JAMP is a seven-transmembrane protein that is a regulator of JNK/MAPK8 activity in response to various stress stimuli. This regulation is part of a broader collective and coordinated response to clearing misfolded proteins from the ER. JAMP facilit...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our JAMP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol JKAMP