JAM-B/VE-JAM Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: JAM-B/VE-JAM Antibody [NBP2-68604] - Staining of human cell line AF22 shows localization to nucleoplasm & plasma membrane.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

JAM-B/VE-JAM Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit JAM-B/VE-JAM Antibody - BSA Free (NBP2-68604) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GVCYAQRKGYFSKETSFQKSNSSSKATTMS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: JAM2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100
• Control Peptide:

  JAM-B/VE-JAM Recombinant Protein Antigen (NBP2-68604PEP)

Reactivity Notes

Mouse 80%, Rat 80%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for JAM-B/VE-JAM Antibody - BSA Free

• C21orf43
• CD322 antigen
• CD322
• JAM2
• JAMB
• JAM-B
• JAM-BJAM-IT/VE-JAM
• junctional adhesion molecule 2JAM-2
• junctional adhesion molecule B
• PRO245
• Vascular endothelial junction-associated molecule
• VE-JAM
• VE-JAMVEJAMCD322

Background

Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. The protein encoded by this immunoglobulin superfamily gene member is localized in the tight junctions between high endothelial cells. It acts as an adhesive ligand for interacting with a variety of immune cell types and may play a role in lymphocyte homing to secondary lymphoid organs.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: JAM2