JAKMIP1 Antibody - BSA Free

Western Blot: JAKMIP1 Antibody [NBP1-57249] - Hela cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

JAKMIP1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to JAKMIP1(janus kinase and microtubule interacting protein 1) The peptide sequence was selected from the middle region of JAKMIP1. Peptide sequence FLRLQVLEQQHVIDDLSLERERLLRSKRHRGKSLKPPKKHVVETFFGFDE. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: JAKMIP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for JAKMIP1 Antibody - BSA Free

• FLJ31564
• GABA-B receptor-binding protein
• Gababrbp
• JAMIP1Jak and microtubule interacting protein 1
• janus kinase and microtubule interacting protein 1
• marlin-1
• MARLIN1janus kinase and microtubule-interacting protein 1
• Multiple alpha-helices and RNA-linker protein 1
• multiple coiled-coil GABABR1-binding protein

Background

JAKMIP1 associates with microtubules and may play a role in the microtubule-dependent transport of the GABA-B receptor. It may play a role in JAK1 signaling and regulate microtubule cytoskeleton rearrangements.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: JAKMIP1