Jagged 2 Antibody

Western Blot: Jagged 2 Antibody [NBP1-58284] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Immunohistochemistry: Jagged 2 Antibody [NBP1-58284] - Human Bronchial Epithelial Tissue Observed Staining: Membrane of bronchial epithelial tissue Primary Antibody Concentration: 1 : 100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Jagged 2 Antibody Summary

• Immunogen: Synthetic peptides corresponding to JAG2(jagged 2) The peptide sequence was selected from the N terminal of JAG2. Peptide sequence RAQGRGRLPRRLLLLLALWVQAARPMGYFELQLSALRNVNGELLSGACCD. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: JAG2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against JAG2 and was validated on Western blot.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Jagged 2 Antibody

• HJ2
• JAG2
• Jagged 2
• Jagged2
• protein jagged-2
• SER2

Background

The Notch signaling pathway is an intercellular signaling mechanism that is essential for proper embryonic development. Members of the Notch protein family are transmembrane receptors that are critical for various cell fate decisions. JAG2 is one of several ligands that activate Notch and related receptors. The Notch signaling pathway is an intercellular signaling mechanism that is essential for proper embryonic development. Members of the Notch gene family encode transmembrane receptors that are critical for various cell fate decisions. The protein encoded by this gene is one of several ligands that activate Notch and related receptors. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Jagged 2 Antibody (NBP1-58284)(1)

Publication using NBP1-58284

• Peng, W, Chang, M Et al. Lyophilized powder of mesenchymal stem cell supernatant attenuates acute lung injury through the IL-6-p-STAT3-p63-JAG2 pathway. Stem Cell Res Ther 2021-03-29 [PMID: 33781349]

Bioinformatics

• Gene Symbol: JAG2
• Uniprot:
  • Q9Y219(Human)