| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clone | 3K1I8 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Description | Novus Biologicals Rabbit Jagged 2 Antibody (3K1I8) (NBP3-15726) is a recombinant monoclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Jagged 2 (Q9Y219). MRAQGRGRLPRRLLLLLALWVQAARPMGYFELQLSALRNVNGELLSGACCDGDGRTTRAGGCGHDECDTYVRVCLKEYQAKVTPTGPCSYGHGATPVLGG |
| Source | HEK293 |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | JAG2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Jagged 2 Antibody (NBP3-15726)Find related products by research area.
|
|
Notch Antibody Proves Metastatic Lung Cancer Has a Jagged Edge We at Novus Biologicals are one of the leading antibody suppliers for cancer research. In a recent Notch antibody study, the Notch ligand Jagged 2 was found to promote the growth of metastatic lung cancer cells by inhibiting miR-200, which blocks epit... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | JAG2 |