JAB1 Antibody - BSA Free

Western Blot: JAB1 Antibody [NBP1-84370] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Immunocytochemistry/Immunofluorescence: JAB1 Antibody [NBP1-84370] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: JAB1 Antibody [NBP1-84370] - Staining of human skin shows moderate to strong nuclear positivity in epidermal cells.

Western Blot: JAB1 Antibody [NBP1-84370] - Lane 1: Marker [kDa] 229, 112, 84, 48, 32, 27, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunohistochemistry-Paraffin: JAB1 Antibody [NBP1-84370] - Staining of human endometrium shows moderate to strong positivity in glandular cells.

Immunohistochemistry-Paraffin: JAB1 Antibody [NBP1-84370] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: JAB1 Antibody [NBP1-84370] - Staining of human testis shows strong positivity in cells in seminiferous ducts.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

JAB1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: COPS5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  JAB1 Protein (NBP1-84370PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for JAB1 Antibody - BSA Free

• COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis)
• COP9 signalosome complex subunit 5
• COPS5
• CSN5
• CSN5COP9 (constitutive photomorphogenic, Arabidopsis, homolog) subunit 5
• EC 3.4
• JAB1
• JAB138 kDa Mov34 homolog
• Jun activation domain-binding protein 1
• MOV-34
• SGN5
• SGN5MGC3149
• Signalosome subunit 5

Background

The protein encoded by the JAB1 gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. This protein is reported to be involved in the degradation of cyclin-dependent kinase inhibitor CDKN1B/p27Kip1. It is also known to be an coactivator that increases the specificity of JUN/AP1 transcription factors. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: COPS5