TSSK6 Antibody (6F5)

Images

 
Western Blot: TSSK6 Antibody (6F5) [H00083983-M02] - TSSK6 monoclonal antibody (M02), clone 6F5 Analysis of TSSK6 expression in Hela S3 NE.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC
Clone
6F5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TSSK6 Antibody (6F5) Summary

Immunogen
TSSK6 (AAH14611, 174 a.a. ~ 273 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SAAYASPEVLLGIPYDPKKYDVWSMGVVLYVMVTGCMPFDDSDIAGLPRRQKRGVLYPEGLELSERCKALIAELLQFSPSARPSAGQVARNCWLRAGDSG
Specificity
TSSK6 - testis-specific serine kinase 6
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TSSK6
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
Application Notes
ICC/IF and IHC were reported in scientific literature.
Control
HeLa Nuclear Cell Lysate
Publications
Read Publication using
H00083983-M02 in the following applications:

  • 1 publication
  • IHC
    1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TSSK6 Antibody (6F5)

  • Cancer/testis antigen 72
  • CT72TSSK-6
  • EC 2.7.11.1
  • FLJ24002
  • serine/threonine protein kinase SSTK
  • Serine/threonine-protein kinase SSTK
  • Small serine/threonine kinase
  • SSTKTSK-6
  • Testis-specific kinase 6
  • testis-specific serine kinase 6
  • testis-specific serine/threonine-protein kinase 6
  • TSSK4

Background

TSSK6 is a serine/threonine protein kinase that is required for postmeiotic chromatin remodeling and male fertility (Spiridonov et al., 2005 [PubMed 15870294]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00023617-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC
H00083942-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, S-ELISA
NBP1-87104
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-2788
Species: Hu, Mu, Rt, Bv, Fe, Fi, Ha, Pm
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N
NBP2-67817
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83086
Species: Hu, Po
Applications: WB, IHC, IHC-P, ICC
NBP1-54878
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84416
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-61640
Species: Hu, Mu, Rt, Ca, Ch, Fi, Ha, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, MiAr
NBP1-77685
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-76638
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NB100-56346
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
H00083983-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC

Publications for TSSK6 Antibody (H00083983-M02)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 3 applications: ICC/IF, IHC, WB.


Filter By Application
ICC/IF
(1)
IHC
(1)
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for TSSK6 Antibody (H00083983-M02) (0)

There are no reviews for TSSK6 Antibody (H00083983-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TSSK6 Antibody (H00083983-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TSSK6 Products

Bioinformatics Tool for TSSK6 Antibody (H00083983-M02)

Discover related pathways, diseases and genes to TSSK6 Antibody (H00083983-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TSSK6 Antibody (H00083983-M02)

Discover more about diseases related to TSSK6 Antibody (H00083983-M02).
 

Pathways for TSSK6 Antibody (H00083983-M02)

View related products by pathway.

PTMs for TSSK6 Antibody (H00083983-M02)

Learn more about PTMs related to TSSK6 Antibody (H00083983-M02).
 

Research Areas for TSSK6 Antibody (H00083983-M02)

Find related products by research area.

Blogs on TSSK6

There are no specific blogs for TSSK6, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TSSK6 Antibody (6F5) and receive a gift card or discount.

Bioinformatics

Gene Symbol TSSK6
Entrez
Uniprot