Home » TSSK6 » TSSK6 Antibodies » TSSK6 Antibody (6F5)

TSSK6 Antibody (6F5)

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: TSSK6 Antibody (6F5) [H00083983-M02] - TSSK6 monoclonal antibody (M02), clone 6F5 Analysis of TSSK6 expression in Hela S3 NE.
Western Blot: TSSK6 Antibody (6F5) [H00083983-M02] - TSSK6 monoclonal antibody (M02), clone 6F5 Analysis of TSSK6 expression in Hela S3 NE.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC
Clone
6F5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

TSSK6 Antibody (6F5) Summary

Immunogen
TSSK6 (AAH14611, 174 a.a. ~ 273 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SAAYASPEVLLGIPYDPKKYDVWSMGVVLYVMVTGCMPFDDSDIAGLPRRQKRGVLYPEGLELSERCKALIAELLQFSPSARPSAGQVARNCWLRAGDSG
Specificity
TSSK6 - testis-specific serine kinase 6
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TSSK6
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Western Blot 1:500
Application Notes
ICC/IF and IHC were reported in scientific literature.
Control
HeLa Nuclear Cell Lysate
Publications
Read Publication using
H00083983-M02 in the following applications:

  • ICC/IF
    1 publication
  • IHC
    1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TSSK6 Antibody (6F5)

  • Cancer/testis antigen 72
  • CT72TSSK-6
  • EC 2.7.11.1
  • FLJ24002
  • serine/threonine protein kinase SSTK
  • Serine/threonine-protein kinase SSTK
  • Small serine/threonine kinase
  • SSTKTSK-6
  • Testis-specific kinase 6
  • testis-specific serine kinase 6
  • testis-specific serine/threonine-protein kinase 6
  • TSSK4

Background

TSSK6 is a serine/threonine protein kinase that is required for postmeiotic chromatin remodeling and male fertility (Spiridonov et al., 2005 [PubMed 15870294]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

TSSK2 Antibody
(1E12)
H00023617-M01
Western Blot: TSSK2 Antibody (1E12) [H00023617-M01] - Analysis of TSSK2 expression in transfected 293T cell line by TSSK2 monoclonal antibody (M01), clone 1E12.Lane 1: TSSK2 transfected lysate(41 KDa).Lane 2: Non-transfected lysate.
Western Blot: TSSK2 Antibody (1E12) [H00023617-M01] - TSSK2 monoclonal antibody (M01), clone 1E12 Analysis of TSSK2 expression in HL-60.
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
TSSK1 Antibody
(4F12)
H00083942-M01
Western Blot: TSSK1 Antibody (4F12) [H00083942-M01] - Analysis of TSSK1 expression in transfected 293T cell line by TSSK1 monoclonal antibody (M01), clone 4F12.Lane 1: TSSK1 transfected lysate(41.6 KDa).Lane 2: Non-transfected lysate.
ELISA: TSSK1 Antibody (4F12) [H00083942-M01] - Detection limit for recombinant GST tagged TSSK1 is approximately 0.03ng/ml as a capture antibody.
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
CACYBP Antibody
NBP1-87104
Immunocytochemistry/Immunofluorescence: CACYBP Antibody [NBP1-87104] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Western Blot: CACYBP Antibody [NBP1-87104] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: CACYBP Antibody [NBP1-87104] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
HSPA8/HSC71/Hsc70
Antibody (13D3)
NB120-2788
Immunocytochemistry/Immunofluorescence: Hsp70 / Hsc70 Antibody (13D3) [NB120-2788] - Formalin fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 10 minutes at room temperature and blocked with 1% Blocker BSA for 15 minutes at room temperature. Cells were probed with a HSP70 monoclonal antibody at a dilution of 1:50 for at least 1 hour at room temperature, washed with PBS, and incubated with DyLight 488 goat anti-mouse IgG secondary antibody at a dilution of 1:400 for 30 minutes at room temperature. Nuclei (blue) were stained with Hoechst 33342 dye.
Immunocytochemistry/Immunofluorescence: Hsp70 / Hsc70 Antibody (13D3) [NB120-2788] - Analysis of HSC70 using HSC70 Monoclonal antibody (13D3) shows staining in HeLa cells. HSC70 staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing HSC70 at a dilution of 1:20-1:200 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Immunocytochemistry/Immunofluorescence: Hsp70 / Hsc70 Antibody (13D3) [NB120-2788] - Analysis of HSC70 using HSC70 Monoclonal antibody (13D3) shows staining in MCF-7 cells. HSC70 staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing HSC70 at a dilution of 1:20-1:200 C, washed with PBS and incubated with a DyLight-488 conjugated.
(2 Reviews)
(21 Publications)
Species: Bv, Fe, Fi, Ha, Hu, Mu, Pm, Rt
Applications: B/N, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
HspA4 Antibody
(SD0861)
NBP2-67817
Flow Cytometry: HspA4 Antibody (SD0861) [NBP2-67817] - Analysis of Hela cells with HSPA4 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: HspA4 Antibody (SD0861) [NBP2-67817] - Staining HSPA4 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: HspA4 Antibody (SD0861) [NBP2-67817] - Staining HSPA4 in HepG2 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Cdk5 Antibody
NBP2-15843
Western Blot: Cdk5 Antibody [NBP2-15843] - Wild-type (WT) and CDK5 knockout (KO) 293T cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with CDK5 antibody diluted at 1:500. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody
Immunohistochemistry-Paraffin: Cdk5 Antibody [NBP2-15843] - ES2 xenograft, using CDK5 antibody at 1:100 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
Immunocytochemistry/Immunofluorescence: Cdk5 Antibody [NBP2-15843] - Analysis of paraformaldehyde-fixed A549, using antibody at 1:200 dilution.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
IZUMO1 Antibody
NBP1-83086
Western Blot: IZUMO1 Antibody [NBP1-83086] - Analysis in control (vector only transfected HEK293T lysate) and IZUMO1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: IZUMO1 Antibody [NBP1-83086] - Analysis in human testis and liver tissues. Corresponding IZUMO1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: IZUMO1 Antibody [NBP1-83086] - Staining of human cerebral cortex shows no positivity in neurons as expected.
(1 Review)
(1 Publication)
Species: Hu, Po
Applications: ICC, IHC, IHC-P, WB
TSKS Antibody
NBP1-54878
Immunohistochemistry: TSKS Antibody [NBP1-54878] - Staining of human Testis.
Western Blot: TSKS Antibody [NBP1-54878] - HepG2 cell lysate, concentration 1 ug/ml.
Immunohistochemistry-Paraffin: TSKS Antibody [NBP1-54878] - Human Testis Tissue, 5.0ug/ml.
Species: Hu
Applications: IHC, IHC-P, WB
CCDC6 Antibody
NBP1-85351
Immunohistochemistry-Paraffin: CCDC6 Antibody [NBP1-85351] - Staining of human fallopian tube shows high expression.
Immunohistochemistry-Paraffin: CCDC6 Antibody [NBP1-85351] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: CCDC6 Antibody [NBP1-85351] - Staining in human fallopian tube and skeletal muscle tissues using anti-CCDC6 antibody. Corresponding CCDC6 RNA-seq data are presented for the same tissues.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
RBM14 Antibody
NBP1-84416
Immunocytochemistry/Immunofluorescence: RBM14 Antibody [NBP1-84416] - Staining of human cell line A-431 shows localization to nuclear speckles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RBM14 Antibody [NBP1-84416] - Analysis in human testis and liver tissues using NBP1-84416 antibody. Corresponding RBM14 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: RBM14 Antibody [NBP1-84416] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
HSP90 beta
Antibody (H9010)
NB110-61640
Immunohistochemistry-Paraffin: HSP90AB1 Antibody (H90-10) [NB110-61640] - Cancerous human colon tissue.
Immunohistochemistry: HSP90AB1 Antibody (H90-10) [NB110-61640] - Mouse inflammed colon tissue. Fixation: Formalin. Primary antibody at 1:10000 for 12 hours at 4C. Secondary antibody: Alexa Fluor 555 Goat Anti-Mouse (red) at 1:5000 for 1 hour at RT. Localization: Inflammatory and epithelial mucosa. Magnification: 40x.
Western Blot: HSP90AB1 Antibody (H90-10) [NB110-61640] - Human cell lysates from various cell lines showing detection of Hsp90 protein using Mouse Anti-Hsp90 Monoclonal Antibody, Clone H9010. 15 ug protein each lane. Block: 1.5% BSA for 30 minutes at RT. Primary antibody at 1:1000 for 2 hours at RT. Secondary antibody: Sheep Anti-Mouse IgG: HRP for 1 hour at RT.
(5 Reviews)
(3 Publications)
Species: Ca, Ch, Fi, Ha, Hu, Mu, Rb, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, MiAr, WB
HSP90 alpha
Antibody - BSA Free
NBP1-77685
Simple Western: HSP90 alpha Antibody [NBP1-77685] - Image shows a specific band for Hsp90A in 0.5 mg/mL of HepG2 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Immunocytochemistry/Immunofluorescence: HSP90 alpha Antibody [NBP1-77685] - HSP901a antibody was tested in MCF-7 cells with FITC (green). Nuclei and actin were counterstained with DAPI (blue) and Phalloidin (red).
Immunohistochemistry: HSP90 alpha Antibody [NBP1-77685] - Staining of human kidney carcinoma in HSP901A using DAB with hematoxylin counterstain.
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Serum-starved MCF‑7 human breast cancer cells were unstimulated (light orange filled histogram) or activated with 100 ng/mL Recombinant human IGF-1 (Catalog # 291-G1, dark orange filled histogram) for 15 minutes, then stained with Rabbit Anti-Human/Mouse/Rat Phospho‑Akt (S473) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF887) or control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(27 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
p53 DINP1 Antibody
- BSA Free
NBP1-76638
Immunofluorescence: p53 DINP1 Antibody [NBP1-76638] - Staining of p53DINP1 in human liver tissue with p53DINP1 antibody at 5 ug/ml.
Western Blot: p53 DINP1 Antibody [NBP1-76638] - Western blotting showing TP53INP1 protein levels in NIH-H460 cells treated LNA-663. TUBULIN was used as protein loading control. Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41419-017-0080-x) licensed under a CC-BY licence.
Western Blot: p53 DINP1 Antibody [NBP1-76638] - Expression in human lung tissue lysate with p53DINP1 antibody at (A) 0.5 and (B) 1 u/mL.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, IF, IHC, IHC-P, WB
Histone H2a
Antibody
NB100-56346
Western Blot: Histone H2a Antibody [NB100-56346] - Analysis of Histone H2A in human PBMC lysate probed with Histone H2A antibody.
Western Blot: Histone H2a Antibody [NB100-56346] - Histone H2A in MCF-7 and HCT-116 cells. Image from verified customer review.
Immunohistochemistry-Paraffin: Histone H2a Antibody [NB100-56346] - Human breast probed with Histone H2A antibody at 5 ug/ml. Staining of formalin-fixed tissues is enhanced by boiling tissue sections in 10 mM sodium citrate buffer, pH 6.0 for 10-20 min followed by cooling at RT for 20 min.
(1 Review)
(3 Publications)
Species: Hu, Mu, Sh
Applications: ELISA, Flow, IHC, IHC-P, WB
TSSK6 Antibody
(6F5)
H00083983-M02
TSSK6 Antibody (6F5)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC

Publications for TSSK6 Antibody (H00083983-M02)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 3 applications: ICC/IF, IHC, WB.


Filter By Application
ICC/IF
(1)
IHC
(1)
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for TSSK6 Antibody (H00083983-M02) (0)

There are no reviews for TSSK6 Antibody (H00083983-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TSSK6 Antibody (H00083983-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

HeLa Nuclear Cell Lysate

Secondary Antibodies

 

Isotype Controls

Additional TSSK6 Products

Bioinformatics Tool for TSSK6 Antibody (H00083983-M02)

Discover related pathways, diseases and genes to TSSK6 Antibody (H00083983-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TSSK6 Antibody (H00083983-M02)

Discover more about diseases related to TSSK6 Antibody (H00083983-M02).
 

Pathways for TSSK6 Antibody (H00083983-M02)

View related products by pathway.

PTMs for TSSK6 Antibody (H00083983-M02)

Learn more about PTMs related to TSSK6 Antibody (H00083983-M02).
 

Research Areas for TSSK6 Antibody (H00083983-M02)

Find related products by research area.

Blogs on TSSK6

There are no specific blogs for TSSK6, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TSSK6 Antibody (6F5) and receive a gift card or discount.


Bioinformatics

Gene Symbol TSSK6
Entrez
Uniprot