Home » TSSK6 » TSSK6 Antibodies » TSSK6 Antibody (6F5)

TSSK6 Antibody (6F5)

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: TSSK6 Antibody (6F5) [H00083983-M02] - TSSK6 monoclonal antibody (M02), clone 6F5 Analysis of TSSK6 expression in Hela S3 NE.
Western Blot: TSSK6 Antibody (6F5) [H00083983-M02] - TSSK6 monoclonal antibody (M02), clone 6F5 Analysis of TSSK6 expression in Hela S3 NE.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC
Clone
6F5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

TSSK6 Antibody (6F5) Summary

Immunogen
TSSK6 (AAH14611, 174 a.a. ~ 273 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SAAYASPEVLLGIPYDPKKYDVWSMGVVLYVMVTGCMPFDDSDIAGLPRRQKRGVLYPEGLELSERCKALIAELLQFSPSARPSAGQVARNCWLRAGDSG
Specificity
TSSK6 - testis-specific serine kinase 6
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TSSK6
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
Application Notes
ICC/IF and IHC were reported in scientific literature.
Control
HeLa Nuclear Cell Lysate
Publications
Read Publication using
H00083983-M02 in the following applications:

  • ICC/IF
    1 publication
  • IHC
    1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TSSK6 Antibody (6F5)

  • Cancer/testis antigen 72
  • CT72TSSK-6
  • EC 2.7.11.1
  • FLJ24002
  • serine/threonine protein kinase SSTK
  • Serine/threonine-protein kinase SSTK
  • Small serine/threonine kinase
  • SSTKTSK-6
  • Testis-specific kinase 6
  • testis-specific serine kinase 6
  • testis-specific serine/threonine-protein kinase 6
  • TSSK4

Background

TSSK6 is a serine/threonine protein kinase that is required for postmeiotic chromatin remodeling and male fertility (Spiridonov et al., 2005 [PubMed 15870294]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

TSSK2 Antibody
(1E12)
H00023617-M01
Western Blot: TSSK2 Antibody (1E12) [H00023617-M01] - TSSK2 monoclonal antibody (M01), clone 1E12 Analysis of TSSK2 expression in HL-60.
Western Blot: TSSK2 Antibody (1E12) [H00023617-M01] - Analysis of TSSK2 expression in transfected 293T cell line by TSSK2 monoclonal antibody (M01), clone 1E12.Lane 1: TSSK2 transfected lysate(41 KDa).Lane 2: Non-transfected lysate.
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC
TSSK1 Antibody
(4F12)
H00083942-M01
Western Blot: TSSK1 Antibody (4F12) [H00083942-M01] - Analysis of TSSK1 expression in transfected 293T cell line by TSSK1 monoclonal antibody (M01), clone 4F12.Lane 1: TSSK1 transfected lysate(41.6 KDa).Lane 2: Non-transfected lysate.
ELISA: TSSK1 Antibody (4F12) [H00083942-M01] - Detection limit for recombinant GST tagged TSSK1 is approximately 0.03ng/ml as a capture antibody.
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, S-ELISA
CACYBP Antibody
NBP1-87104
Western Blot: CACYBP Antibody [NBP1-87104] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: CACYBP Antibody [NBP1-87104] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: CACYBP Antibody [NBP1-87104] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
HSPA8/HSC71/Hsc70
Antibody (13D3)
NB120-2788
Western Blot: Hsp70 / Hsc70 Antibody (13D3) [NB120-2788] - Proteins were transferred to a PVDF membrane and blocked with 5% BSA/TBST for at least 1 hour. The membrane was probed with a HSP70 monoclonal antibody at a dilution of 1:1000 overnight at 4C on a rocking platform, washed in TBS-0.1%Tween 20, and probed with a goat anti-mouse IgM-HRP secondary antibody at a dilution of 1:20,000 for at least 1 hour.
Immunocytochemistry/Immunofluorescence: Hsp70 / Hsc70 Antibody (13D3) [NB120-2788] - Analysis of HSC70 using Monoclonal antibody (13D3) shows staining in NIH-3T3 cells. HSC70 staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing HSC70 at a dilution of 1:20-1:200 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Immunohistochemistry-Paraffin: Hsp70 / Hsc70 Antibody (13D3) [NB120-2788] - Both normal and cancer biopsies of deparaffinized human Prostate carcinoma tissue.
(2 Reviews)
(16 Publications)
Species: Hu, Mu, Rt, Bv, Fe, Fi, Ha, Pm
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N
HspA4 Antibody
(SD0861)
NBP2-67817
Western Blot: HspA4 Antibody (SD0861) [NBP2-67817] - Analysis of HSPA4 on Hela cells lysates using anti-HSPA4 antibody at 1/1,000 dilution.
Immunocytochemistry/Immunofluorescence: HspA4 Antibody (SD0861) [NBP2-67817] - Staining HSPA4 in HepG2 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: HspA4 Antibody (SD0861) [NBP2-67817] - Analysis of paraffin-embedded rat brain tissue using anti-HSPA4 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Cdk5 Antibody
NBP2-15843
Western Blot: Cdk5 Antibody [NBP2-15843] - Wild-type (WT) and CDK5 knockout (KO) 293T cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with CDK5 antibody diluted at 1:500. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody
Immunocytochemistry/Immunofluorescence: Cdk5 Antibody [NBP2-15843] - Analysis of paraformaldehyde-fixed A549, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: Cdk5 Antibody [NBP2-15843] - Rat hind brain. CDK5 antibody [C2C3], C-term dilution: 1:500. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
IZUMO1 Antibody
NBP1-83086
Western Blot: IZUMO1 Antibody [NBP1-83086] - Protein extracts from four different pig ejaculates and a human sample. Lanes F: fresh sperm. Lanes F-T: frozen-thawed sperm. Lanes H: human fresh sperm. Image from verified customer review.
Immunohistochemistry-Paraffin: IZUMO1 Antibody [NBP1-83086] - Staining of human liver shows no positivity in hepatocytes as expected.
Western Blot: IZUMO1 Antibody [NBP1-83086] - Analysis in control (vector only transfected HEK293T lysate) and IZUMO1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
(1 Review)
(1 Publication)
Species: Hu, Po
Applications: WB, IHC, IHC-P, ICC
TSKS Antibody
NBP1-54878
Western Blot: TSKS Antibody [NBP1-54878] - HepG2 cell lysate, concentration 1 ug/ml.
Immunohistochemistry-Paraffin: TSKS Antibody [NBP1-54878] - Human Testis Tissue, 5.0ug/ml.
Immunohistochemistry: TSKS Antibody [NBP1-54878] - Staining of human Testis.
Species: Hu
Applications: WB, IHC, IHC-P
CCDC6 Antibody
NBP1-85351
Western Blot: CCDC6 Antibody [NBP1-85351] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: CCDC6 Antibody [NBP1-85351] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CCDC6 Antibody [NBP1-85351] - Staining of human liver shows no positivity in hepatocytes as expected.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
RBM14 Antibody
NBP1-84416
Western Blot: RBM14 Antibody [NBP1-84416] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/Immunofluorescence: RBM14 Antibody [NBP1-84416] - Staining of human cell line A-431 shows localization to nuclear speckles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RBM14 Antibody [NBP1-84416] - Staining of human cerebral cortex shows strong nuclear and moderate cytoplasmic positivity in both neuronal cells and glial cells.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
HSP90 beta
Antibody (H9010)
NB110-61640
Western Blot: HSP90AB1 Antibody (H90-10) [NB110-61640] - HCC827 human non-small cell lung cancer cell line and A549 cells lysates. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: HSP90AB1 Antibody (H90-10) [NB110-61640] - Tissue: backskin. Species: Mouse. Fixation: Bouins Fixative and paraffin-embedded. Primary Antibody: Mouse Anti-Hsp90 Monoclonal Antibody at 1:100 for 1 hour at RT. Secondary Antibody: FITC Goat Anti-Mouse (green) at 1:50 for 1 hour at RT. Localization: Epidermis.
Immunohistochemistry-Paraffin: HSP90AB1 Antibody (H90-10) [NB110-61640] - Tissue: inflamed colon. Species: Mouse. Fixation: Formalin. Primary Antibody: Mouse Anti-Hsp90 Monoclonal Antibody at 1:10000 for 12 hours at 4C. Secondary Antibody: Biotin Goat Anti-Mouse at 1:2000 for 1 hour at RT. Counterstain: Mayer Hematoxylin (purple/blue) nuclear stain at 200 ul for 2 minutes at RT. Localization: Inflammatory cells. Magnification: 40x.
(5 Reviews)
(2 Publications)
Species: Hu, Mu, Rt, Ca, Ch, Fi, Ha, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, MiAr
HSP90 alpha
Antibody
NBP1-77685
Western Blot: HSP90 alpha Antibody [NBP1-77685] - Analysis of HSP901a in 1: HeLa. 2: Ntera2. 3: A431. 4: HepG2. 5: MCF7. 6: NIH/3T3. 7: PC12. 8: COS7.
Immunocytochemistry/Immunofluorescence: HSP90 alpha Antibody [NBP1-77685] - HSP901a antibody was tested in MCF-7 cells with FITC (green). Nuclei and actin were counterstained with DAPI (blue) and Phalloidin (red).
Immunohistochemistry: HSP90 alpha Antibody [NBP1-77685] - Staining of human kidney carcinoma in HSP901A using DAB with hematoxylin counterstain.
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Serum-starved MCF‑7 human breast cancer cells were unstimulated (light orange filled histogram) or activated with 100 ng/mL Recombinant human IGF-1 (Catalog # 291-G1, dark orange filled histogram) for 15 minutes, then stained with Rabbit Anti-Human/Mouse/Rat Phospho‑Akt (S473) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF887) or control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(23 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
p53 DINP1 Antibody
NBP1-76638
Western Blot: p53 DINP1 Antibody [NBP1-76638] - Expression in human lung tissue lysate with p53DINP1 antibody at (A) 0.5 and (B) 1 u/mL.
Immunohistochemistry-Paraffin: p53 DINP1 Antibody [NBP1-76638] - Mouse liver using p53DINP1 antibody at 2 ug/ml.
Immunofluorescence: p53 DINP1 Antibody [NBP1-76638] - Staining of p53DINP1 in human liver tissue with p53DINP1 antibody at 5 ug/ml.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
Histone H2a
Antibody
NB100-56346
Western Blot: Histone H2a Antibody [NB100-56346] - Histone H2A in MCF-7 and HCT-116 cells. Image from verified customer review.
Immunohistochemistry-Paraffin: Histone H2a Antibody [NB100-56346] - Human breast probed with Histone H2A antibody at 5 ug/ml. Staining of formalin-fixed tissues is enhanced by boiling tissue sections in 10 mM sodium citrate buffer, pH 6.0 for 10-20 min followed by cooling at RT for 20 min.
Western Blot: Histone H2a Antibody [NB100-56346] - Analysis of Histone H2A in human PBMC lysate probed with Histone H2A antibody.
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
TSSK6 Antibody
(6F5)
H00083983-M02
TSSK6 Antibody (6F5)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC

Publications for TSSK6 Antibody (H00083983-M02)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 3 applications: ICC/IF, IHC, WB.


Filter By Application
ICC/IF
(1)
IHC
(1)
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for TSSK6 Antibody (H00083983-M02) (0)

There are no reviews for TSSK6 Antibody (H00083983-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TSSK6 Antibody (H00083983-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

HeLa Nuclear Cell Lysate

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional TSSK6 Products

Bioinformatics Tool for TSSK6 Antibody (H00083983-M02)

Discover related pathways, diseases and genes to TSSK6 Antibody (H00083983-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TSSK6 Antibody (H00083983-M02)

Discover more about diseases related to TSSK6 Antibody (H00083983-M02).
 

Pathways for TSSK6 Antibody (H00083983-M02)

View related products by pathway.

PTMs for TSSK6 Antibody (H00083983-M02)

Learn more about PTMs related to TSSK6 Antibody (H00083983-M02).
 

Research Areas for TSSK6 Antibody (H00083983-M02)

Find related products by research area.

Blogs on TSSK6

There are no specific blogs for TSSK6, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TSSK6 Antibody (6F5) and receive a gift card or discount.


Bioinformatics

Gene Symbol TSSK6
Entrez
Uniprot