TEX101 Antibody


Western Blot: TEX101 Antibody [NBP1-84357] - Analysis in human testis tissue.
Immunohistochemistry-Paraffin: TEX101 Antibody [NBP1-84357] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

TEX101 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:ELYCQKGLSMTVEADPANMFNWTTEEVETCDKGALCQETILIIKAGTETAILATKGCIPEGEEAITIVQHSSPPG
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TEX101 Protein (NBP1-84357PEP)
Read Publications using NBP1-84357.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23276153)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TEX101 Antibody

  • cancer/testis antigen 131
  • Cell surface receptor NYD-SP8
  • CT131
  • MGC4766
  • NYD-SP8
  • PRO1884
  • Scleroderma-associated autoantigen
  • Spermatogenesis-related gene protein
  • TES101RP
  • testis expressed 101
  • testis expressed sequence 101
  • testis-expressed protein 101
  • testis-specific protein TES101RP


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Species: Bv
Applications: WB
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Eq, Pm
Applications: WB, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for TEX101 Antibody (NBP1-84357)(2)

Reviews for TEX101 Antibody (NBP1-84357) (0)

There are no reviews for TEX101 Antibody (NBP1-84357). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TEX101 Antibody (NBP1-84357) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TEX101 Products

Bioinformatics Tool for TEX101 Antibody (NBP1-84357)

Discover related pathways, diseases and genes to TEX101 Antibody (NBP1-84357). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TEX101 Antibody (NBP1-84357)

Discover more about diseases related to TEX101 Antibody (NBP1-84357).

Pathways for TEX101 Antibody (NBP1-84357)

View related products by pathway.

PTMs for TEX101 Antibody (NBP1-84357)

Learn more about PTMs related to TEX101 Antibody (NBP1-84357).

Blogs on TEX101

There are no specific blogs for TEX101, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TEX101 Antibody and receive a gift card or discount.


Gene Symbol TEX101