TEX101 Antibody

Images

 
Western Blot: TEX101 Antibody [NBP1-84357] - Analysis in human testis tissue.
Immunohistochemistry-Paraffin: TEX101 Antibody [NBP1-84357] - Staining in human testis and kidney tissues using anti-TEX101 antibody. Corresponding TEX101 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: TEX101 Antibody [NBP1-84357] - Staining of human kidney shows low expression as expected.
Immunohistochemistry-Paraffin: TEX101 Antibody [NBP1-84357] - Staining of human testis shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TEX101 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ELYCQKGLSMTVEADPANMFNWTTEEVETCDKGALCQETILIIKAGTETAILATKGCIPEGEEAITIVQHSSPPG
Specificity
Specificity of human TEX101 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TEX101
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TEX101 Protein (NBP1-84357PEP)
Publications
Read Publications using NBP1-84357.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23276153)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TEX101 Antibody

  • cancer/testis antigen 131
  • Cell surface receptor NYD-SP8
  • CT131
  • MGC4766
  • NYD-SP8
  • PRO1884
  • Scleroderma-associated autoantigen
  • SGRGGTPR867
  • Spermatogenesis-related gene protein
  • TES101RP
  • testis expressed 101
  • testis expressed sequence 101
  • testis-expressed protein 101
  • testis-specific protein TES101RP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00146852-P01
Species: Hu
NBP1-81637
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NBP1-83086
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92065
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF972
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-47714
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45719
Species: Hu
Applications: WB, IHC
NBP2-24405
Species: Hu
Applications: WB, ELISA
NBP1-91448
Species: Hu
Applications: WB
NBP2-67503
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-00932
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-510
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
NBP2-32395
Species: Hu
Applications: IHC, IHC-P
NBP1-90614
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-48336
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84357
Species: Hu
Applications: WB, IHC, IHC-P

Publications for TEX101 Antibody (NBP1-84357)(2)

Reviews for TEX101 Antibody (NBP1-84357) (0)

There are no reviews for TEX101 Antibody (NBP1-84357). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TEX101 Antibody (NBP1-84357) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TEX101 Products

Bioinformatics Tool for TEX101 Antibody (NBP1-84357)

Discover related pathways, diseases and genes to TEX101 Antibody (NBP1-84357). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TEX101 Antibody (NBP1-84357)

Discover more about diseases related to TEX101 Antibody (NBP1-84357).
 

Pathways for TEX101 Antibody (NBP1-84357)

View related products by pathway.

PTMs for TEX101 Antibody (NBP1-84357)

Learn more about PTMs related to TEX101 Antibody (NBP1-84357).

Blogs on TEX101

There are no specific blogs for TEX101, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TEX101 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TEX101