| Reactivity | HuSpecies Glossary |
| Applications | AC |
| Description | A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IZUMO1. Source: E. coli Amino Acid Sequence: VVLALKSLEKDYLPGHLDAKHHKAMMERVENAVKDFQELSLNEDAYMGVVDEATLQKGSWSLLKDLKRITDSDVKGDLFVKELFWMLHLQKETFATYVARFQKEAYCPNKCGVMLQTLIWCKNCKKEVHACRKSYDCGERNVEVPQM Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) |
| Source | E. coli |
| Protein/Peptide Type | Recombinant Protein Antigen |
| Gene | IZUMO1 |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
|
| Application Notes | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83086. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking peptide related information and a protocol, click here. |
|
| Theoretical MW | 35 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Reviewed Applications |
|
|
| Publications |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
-Flow-Cytometry-NB500-327-img0006.jpg)
-Flow-Cytometry-NB500-327-img0007.jpg)
-Flow-Cytometry-NB500-327-img0008.jpg)
![Immunohistochemistry ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Immunohistochemistry_6703.jpg)
![Western Blot ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Flow_Cytometry_20028.jpg)
![Simple Western ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Simple_Western_20109.jpg)
-ELISA-NBP2-37348-img0001.jpg)
-Western-Blot-NBP2-37348-img0002.jpg)
-Western-Blot-NBP2-37348-img0003.jpg)
-Flow-Cytometry-NB100-524-img0014.jpg)
-Flow-Cytometry-NB100-524-img0015.jpg)
-Immunohistochemistry-Frozen-NB100-524-img0016.jpg)
---Azide-and-BSA-Free-Protein-Array-NBP2-79843-img0001.jpg)
---Azide-and-BSA-Free-Immunocytochemistry-Immunofluorescence-NBP2-79843-img0002.jpg)
---Azide-and-BSA-Free-Western-Blot-NBP2-79843-img0003.jpg)
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
-Immunofluorescence-NBP2-46005-img0001.jpg)
-Immunofluorescence-NBP2-46005-img0002.jpg)
-Immunohistochemistry-NBP2-46005-img0003.jpg)
| Publication using NBP1-83086PEP | Applications | Species |
|---|---|---|
| Llavanera M, Delgado-Bermúdez A, Fernandez-Fuertes B, et al. GSTM3, but not IZUMO1, is a cryotolerance marker of boar sperm. J Anim Sci Biotechnol. 2019-08-05 [PMID: 31391940] (ICC, WB, Human, Porcine) | ICC, WB | Human, Porcine |
| Images | Ratings | Applications | Species | Date | Details | ||||
|---|---|---|---|---|---|---|---|---|---|
|
reviewed by:
Verified Customer |
Used as a blocking peptide for IZUMO1 antibody (NBP1-83086) in Western blot | 07/11/2019 |
Summary
|
PTMs for IZUMO1 Recombinant Protein Antigen (NBP1-83086PEP)Learn more about PTMs related to IZUMO1 Recombinant Protein Antigen (NBP1-83086PEP).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Verified Customer 07/11/2019 |
||
| Application: | Used as a blocking peptide for IZUMO1 antibody (NBP1-83086) in Western blot | |
| Species: |
| Gene Symbol | IZUMO1 |
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
-Western-Blot-H00083983-M02-img0002.jpg)
)-Western-Blot-NB100-62346-img0002.jpg)
)-Immunohistochemistry-NB100-62346-img0003.jpg)
)-Western-Blot-NB100-62346-img0001.jpg)
![Western Blot: IZUMO1 Antibody [NBP1-83086] - Analysis in control (vector only transfected HEK293T lysate) and IZUMO1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](https://images.novusbio.com/images2/IZUMO1-Antibody-Western-Blot-NBP1-83086-img0011.jpg "Western Blot: IZUMO1 Antibody [NBP1-83086] - Analysis in control (vector only transfected HEK293T lysate) and IZUMO1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")