IZUMO1 Antibody


Western Blot: IZUMO1 Antibody [NBP1-62704] - Human Heart lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

IZUMO1 Antibody Summary

Synthetic peptides corresponding to IZUMO1(izumo sperm-egg fusion 1) The peptide sequence was selected form the C terminal of IZUMO1. Peptide sequence SLALITGLTFAIFRRRKVIDFIKSSLFGLGSGAAEQTQVPKEKATDSRQQ.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
Application Notes
This is a rabbit polyclonal antibody against IZUMO1 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for IZUMO1 Antibody

  • FLJ61440
  • izumo sperm-egg fusion 1
  • izumo sperm-egg fusion protein 1
  • IZUMO1
  • MGC34799
  • OBF
  • Oocyte binding/fusion factor
  • Sperm-specific protein izumo


The sperm-specific protein Izumo, named for a Japanese shrine dedicated to marriage, is essential for sperm-egg plasma membrane binding and fusion.The sperm-specific protein Izumo, named for a Japanese shrine dedicated to marriage, is essential for sperm-egg plasma membrane binding and fusion (Inoue et al., 2005 [PubMed 15759005]).[supplied by OMIM].


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, IF
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IF
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for IZUMO1 Antibody (NBP1-62704) (0)

There are no publications for IZUMO1 Antibody (NBP1-62704).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IZUMO1 Antibody (NBP1-62704) (0)

There are no reviews for IZUMO1 Antibody (NBP1-62704). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IZUMO1 Antibody (NBP1-62704) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for IZUMO1 Antibody (NBP1-62704)

Discover related pathways, diseases and genes to IZUMO1 Antibody (NBP1-62704). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IZUMO1 Antibody (NBP1-62704)

Discover more about diseases related to IZUMO1 Antibody (NBP1-62704).

Pathways for IZUMO1 Antibody (NBP1-62704)

View related products by pathway.

PTMs for IZUMO1 Antibody (NBP1-62704)

Learn more about PTMs related to IZUMO1 Antibody (NBP1-62704).

Blogs on IZUMO1

There are no specific blogs for IZUMO1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our IZUMO1 Antibody and receive a gift card or discount.


Gene Symbol IZUMO1