ITGB1BP3 Antibody


Western Blot: ITGB1BP3 Antibody [NBP1-53033] - Human Thymus lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

ITGB1BP3 Antibody Summary

Synthetic peptides corresponding to ITGB1BP3(integrin beta 1 binding protein 3) The peptide sequence was selected from the middle region of ITGB1BP3. Peptide sequence YKPLVDLYSRRYFLTVPYEECKWRRSTRNYTVPDPPGLFDGHVWPMYQKY.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ITGB1BP3 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ITGB1BP3 Antibody

  • EC
  • EC 2.7.1.n4
  • integrin beta 1 binding protein 3
  • Integrin beta-1-binding protein 3
  • MGC126624
  • Muscle integrin-binding protein
  • muscle-specific beta 1 integrin binding protein
  • nicotinamide riboside kinase 2
  • Nicotinic acid riboside kinase 2
  • NmR-K 2
  • NRK2RNK 2
  • Ribosylnicotinamide kinase 2
  • Ribosylnicotinic acid kinase 2


ITGB1BP3 catalyzes the phosphorylation of nicotinamide riboside (NR) and nicotinic acid riboside (NaR) to form nicotinamide mononucleotide (NMN) and nicotinic acid mononucleotide (NaMN).ITGB1BP3 reduces laminin matrix deposition and cell adhesion to lami


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
Species: Hu
Applications: IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IP
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
Species: Hu
Applications: WB, IHC, IHC-P, KD
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, PEP-ELISA
Species: Hu, Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB

Publications for ITGB1BP3 Antibody (NBP1-53033) (0)

There are no publications for ITGB1BP3 Antibody (NBP1-53033).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ITGB1BP3 Antibody (NBP1-53033) (0)

There are no reviews for ITGB1BP3 Antibody (NBP1-53033). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ITGB1BP3 Antibody (NBP1-53033) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ITGB1BP3 Products

Bioinformatics Tool for ITGB1BP3 Antibody (NBP1-53033)

Discover related pathways, diseases and genes to ITGB1BP3 Antibody (NBP1-53033). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ITGB1BP3 Antibody (NBP1-53033)

Discover more about diseases related to ITGB1BP3 Antibody (NBP1-53033).

Pathways for ITGB1BP3 Antibody (NBP1-53033)

View related products by pathway.

Research Areas for ITGB1BP3 Antibody (NBP1-53033)

Find related products by research area.

Blogs on ITGB1BP3

There are no specific blogs for ITGB1BP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ITGB1BP3 Antibody and receive a gift card or discount.


Gene Symbol NMRK2