ISPD Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ISPD Antibody [NBP2-58091] - Staining of human cell line U-2 OS shows localization to nucleoli fibrillar center.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ISPD Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IVVAVTGENMEVMKSIIQKYQHKRISLVEAGVTRHRSIFNGLKALAEDQINSKLSKPEVVIIHDAVRPFVEEGVLLKVVTAAKEHG
Specificity
Specificity of human ISPD antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ISPD
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ISPD Recombinant Protein Antigen (NBP2-58091PEP)

Reactivity Notes

Mouse 83%, Rat 80%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ISPD Antibody

  • 4-diphosphocytidyl-2C-methyl-D-erythritol synthase homolog
  • isoprenoid synthase domain containing
  • isoprenoid synthase domain-containing protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81451
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45861
Species: Hu
Applications: WB, Flow, IHC, IF
NBP2-58661
Species: Hu
Applications: IHC, IHC-P
NB600-1397
Species: Hu, Bv, Ca, Mk, Rb
Applications: WB, Flow, IHC, IHC-P, IP, MiAr, CyTOF-ready, Flow-IC
NB100-74502
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-86614
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02269
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-55298
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-24613
Species: Hu
Applications: WB, Simple Western, IHC-P
NBP1-85734
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-1353
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-86613
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34252
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-31851
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-58091
Species: Hu
Applications: ICC/IF

Publications for ISPD Antibody (NBP2-58091) (0)

There are no publications for ISPD Antibody (NBP2-58091).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ISPD Antibody (NBP2-58091) (0)

There are no reviews for ISPD Antibody (NBP2-58091). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ISPD Antibody (NBP2-58091) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ISPD Antibody (NBP2-58091)

Discover related pathways, diseases and genes to ISPD Antibody (NBP2-58091). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ISPD Antibody (NBP2-58091)

Discover more about diseases related to ISPD Antibody (NBP2-58091).
 

Pathways for ISPD Antibody (NBP2-58091)

View related products by pathway.

PTMs for ISPD Antibody (NBP2-58091)

Learn more about PTMs related to ISPD Antibody (NBP2-58091).

Blogs on ISPD

There are no specific blogs for ISPD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ISPD Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ISPD