IRX1 Antibody

Images

 
Western Blot: IRX1 Antibody [NBP1-83090] - Analysis in human heart tissue.
Immunocytochemistry/ Immunofluorescence: IRX1 Antibody [NBP1-83090] - Staining of human cell line REH shows localization to the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: IRX1 Antibody [NBP1-83090] - Staining of mouse embryo E14 shows moderate to strong nuclear positivity in developing teeth.
Immunohistochemistry-Paraffin: IRX1 Antibody [NBP1-83090] - Staining of human mouse embryo E14 shows moderate to strong nuclear positivity in developing lung.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IRX1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NKVTWGARSKDQEDGALFGSDTEGDPEKAEDDEEIDLESIDIDKIDEHDGDQSNEDDEDKAEAPHAPAAPSALARDQGSPLAAADVLKPQDS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IRX1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
IRX1 Protein (NBP1-83090PEP)
Publications
Read Publication using
NBP1-83090 in the following applications:

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:34155146). Immunogen displays the following percentage of sequence identity for non-tested species: Rat (85%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IRX1 Antibody

  • Homeodomain protein IRXA1
  • iroquois homeobox 1
  • Iroquois homeobox protein 1
  • iroquois-class homeodomain protein IRX-1
  • IRX-5
  • IRXA1

Background

The Iroquois homeobox gene family of transcription factors regulate aspects of embryonic development including anterior/posterior and dorsal/ventral axis patterning in the central nervous system. The Iroquois family are clustered on two loci, IRXA and IRXB, which map to chromosomes 8 and 13 in mice. The IRXA group includes Irx1, Irx2 and Irx4; the IRXB group is comprises Irx3, Irx5 and Irx6. Irx1 and Irx2 are both widely expressed during development in the lung epithelium and also in the ventricular septum. Irx1 and Irx2 also play a role in digit formation (E11.5-E14.5). The Irx gene family members are each expressed in a distinct pattern during mouse heart development. Specifically, Irx1 and Irx2 are expressed in the ventricular septum and Irx3 is expressed in the ventricular trabeculated myocardium. In addition, Irx4 is expressed in the linear heart tube and the AV canal; Irx5 is expressed in the endocardium lining the ventricular and atrial myocardium. Furthermore, the IRX4 gene may modulate cardiac development and function. Although the heart of Irx4- mice appears to develop normally, adult Irx4- mice exhibit cardiomyopathy, including cardiac hypertrophy and decreased contractility.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00153572-T01
Species: Hu
Applications: WB
H00079191-M05
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
H00010265-M06
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
NB100-56441
Species: Hu, Mu, Rt
Applications: WB
H00253738-M05
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBL1-12041
Species: Hu
Applications: WB
MAB8398
Species: Hu
Applications: CyTOF-ready, Flow
NBP2-13294
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
H00079190-M01
Species: Hu
Applications: ELISA, KD, S-ELISA, WB
H00055079-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB600-600
Species: Ca, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, IB, ICC/IF, IHC, IHC-P, KD, WB
AF2567
Species: Mu
Applications: IHC, WB
AF3690
Species: Hu, Mu
Applications: ChIP, ICC, WB
AF3444
Species: Hu
Applications: IHC, WB
NBP1-46328
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF3168
Species: Hu
Applications: ICC, WB
NBP2-94897
Species: Mu, Rt
Applications: WB
G-125-C
Species: Hu
Applications:
AF3797
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
NBP1-83090
Species: Hu, Mu
Applications: WB, ICC/IF, IHC

Publications for IRX1 Antibody (NBP1-83090)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for IRX1 Antibody (NBP1-83090) (0)

There are no reviews for IRX1 Antibody (NBP1-83090). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IRX1 Antibody (NBP1-83090) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IRX1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IRX1