Recombinant Human IRF6 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human IRF6 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 368 - 467 of Human IRF6 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PFEIYLCFGEEWPDGKPLERKLILVQVIPVVARMIYEMFSGDFTRSFDSGSVRLQISTPDIKDNIVAQLKQLYRILQTQESWQPMQPTPSMQLPPALPPQ

Protein/Peptide Type
Partial Recombinant Protein
Gene
IRF6

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human IRF6 Protein

  • interferon regulatory factor 6
  • IRF6
  • IRF-6
  • LPS
  • OFC6
  • OFC6PPS
  • PIT
  • PPS
  • Van der Woude syndrome
  • VWS
  • VWS1

Background

IRF6 - interferon regulatory factor 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89306
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1195
Species: Hu
Applications: WB, IHC, Neut
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NBP1-26642
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP

Publications for IRF6 Partial Recombinant Protein (H00003664-Q01) (0)

There are no publications for IRF6 Partial Recombinant Protein (H00003664-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IRF6 Partial Recombinant Protein (H00003664-Q01) (0)

There are no reviews for IRF6 Partial Recombinant Protein (H00003664-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IRF6 Partial Recombinant Protein (H00003664-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IRF6 Products

Bioinformatics Tool for IRF6 Partial Recombinant Protein (H00003664-Q01)

Discover related pathways, diseases and genes to IRF6 Partial Recombinant Protein (H00003664-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IRF6 Partial Recombinant Protein (H00003664-Q01)

Discover more about diseases related to IRF6 Partial Recombinant Protein (H00003664-Q01).
 

Pathways for IRF6 Partial Recombinant Protein (H00003664-Q01)

View related products by pathway.

PTMs for IRF6 Partial Recombinant Protein (H00003664-Q01)

Learn more about PTMs related to IRF6 Partial Recombinant Protein (H00003664-Q01).

Blogs on IRF6

There are no specific blogs for IRF6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IRF6 Antibody
NBP1-51911

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human IRF6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol IRF6
Entrez