IRF1 Antibody (1C1)

Images

 
There are currently no images for IRF1 Antibody (H00003659-M02).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1C1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

IRF1 Antibody (1C1) Summary

Immunogen
IRF1 (NP_002189 216 a.a. - 325 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKNMDATWLDSLLTPVRLPSIQAIPCAP
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
IRF1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IRF1 Antibody (1C1)

  • interferon regulatory factor 1
  • IRF1
  • MAR
  • MARIRF-1

Background

IRF1 encodes interferon regulatory factor 1, a member of the interferon regulatory transcription factor (IRF) family. IRF1 serves as an activator of interferons alpha and beta transcription, and in mouse it has been shown to be required for double-stranded RNA induction of these genes. IRF1 also functions as a transcription activator of genes induced by interferons alpha, beta, and gamma. Further, IRF1 has been shown to play roles in regulating apoptosis and tumor-suppressoion.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4049
Species: Hu
Applications: WB, Simple Western
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-31207
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
AF2340
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
AF3749
Species: Hu
Applications: WB, IHC
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5629
Species: Hu, Mu
Applications: WB
NBP1-76917
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
H00003659-M02
Species: Hu
Applications: WB, ELISA

Publications for IRF1 Antibody (H00003659-M02) (0)

There are no publications for IRF1 Antibody (H00003659-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IRF1 Antibody (H00003659-M02) (0)

There are no reviews for IRF1 Antibody (H00003659-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IRF1 Antibody (H00003659-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IRF1 Products

Bioinformatics Tool for IRF1 Antibody (H00003659-M02)

Discover related pathways, diseases and genes to IRF1 Antibody (H00003659-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IRF1 Antibody (H00003659-M02)

Discover more about diseases related to IRF1 Antibody (H00003659-M02).
 

Pathways for IRF1 Antibody (H00003659-M02)

View related products by pathway.

PTMs for IRF1 Antibody (H00003659-M02)

Learn more about PTMs related to IRF1 Antibody (H00003659-M02).
 

Research Areas for IRF1 Antibody (H00003659-M02)

Find related products by research area.

Blogs on IRF1

There are no specific blogs for IRF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IRF1 Antibody (1C1) and receive a gift card or discount.

Bioinformatics

Gene Symbol IRF1
Entrez
Uniprot