IRAK2 Antibody (1A6)

Images

 
Western Blot: IRAK2 Antibody (1A6) [H00003656-M04] - Analysis of IRAK2 expression in PC-12 (Cat # L012V1).
Western Blot: IRAK2 Antibody (1A6) [H00003656-M04] - Analysis of IRAK2 expression in HeLa (Cat # L013V1).
Western Blot: IRAK2 Antibody (1A6) [H00003656-M04] - Analysis of IRAK2 expression in NIH/3T3 (Cat # L018V1).
Sandwich ELISA: IRAK2 Antibody (1A6) [H00003656-M04] - Detection limit for recombinant GST tagged IRAK2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA
Clone
1A6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

IRAK2 Antibody (1A6) Summary

Immunogen
IRAK2 (NP_001561 111 a.a. - 210 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KPEKPLAASVRKAEDEQEEGQPVRMATFPGPGSSPARAHQPAFLQPPEEDAPHSLRSDLPTSSDSKDFSTSIPKQEKLLSLAGDSLFWSEADVVQATDDF
Specificity
IRAK2 - interleukin-1 receptor-associated kinase 2
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
IRAK2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Publications
Read Publication using H00003656-M04.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IRAK2 Antibody (1A6)

  • interleukin-1 receptor associated kinase-2
  • interleukin-1 receptor-associated kinase 2
  • interleukin-1 receptor-associated kinase-like 2
  • IRAK2
  • IRAK-2
  • MGC150550

Background

IRAK2 encodes the interleukin-1 receptor-associated kinase 2, one of two putative serine/threonine kinases that become associated with the interleukin-1 receptor (IL1R) upon stimulation. IRAK2 is reported to participate in the IL1-induced upregulation of NF-kappaB. The pro-inflammatory cytokine IL-1 induces cellular response through two subunits of its receptor, IL-1 receptor I (IL-1RI) and IL-1 receptor accessory protein (IL-1RAcP). IL-1 receptor-associated kinase (IRAK) mediates activation of NF-kB, which is a pivotal transcription factor mediating inflammatory and immune response. A novel member in the IRAK/Pelle family was recently identified and designated IRAK2 (1). Both IRAK and IRAK2 recruit to the subunits of the IL-1R complex after IL-1 binding and lead to NF-kB activation. IRAKs also associate with Toll-like receptor (TLR) and the dominant negative mutants of IRAKs inhibit LPS-induced NF-kB activation (2,3).Members in IRAK/Pelle family play a central role in IL-1R and TLR mediated inflammatory response. IRAK2 is expressed in a variety of human tissues.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56699
Species: Hu, Mu, Rt
Applications: WB, IP
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-29328
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
NB100-56722
Species: Hu, Ca
Applications: WB, B/N, Flow, Func, ICC/IF, IHC-P, IP, Flow-CS
NB500-597
Species: Hu, Mu, Rt
Applications: WB, Flow, IP
NBP1-76782
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-52508
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-24729
Species: Hu, Mu, Rt, Ca, Eq, Pm
Applications: WB, Simple Western, ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, CyTOF-ready, Flow-IC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
H00003656-M04
Species: Hu, Mu, Rt
Applications: WB, ELISA

Publications for IRAK2 Antibody (H00003656-M04)(1)

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
All Species

Reviews for IRAK2 Antibody (H00003656-M04) (0)

There are no reviews for IRAK2 Antibody (H00003656-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IRAK2 Antibody (H00003656-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IRAK2 Products

Bioinformatics Tool for IRAK2 Antibody (H00003656-M04)

Discover related pathways, diseases and genes to IRAK2 Antibody (H00003656-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IRAK2 Antibody (H00003656-M04)

Discover more about diseases related to IRAK2 Antibody (H00003656-M04).
 

Pathways for IRAK2 Antibody (H00003656-M04)

View related products by pathway.

PTMs for IRAK2 Antibody (H00003656-M04)

Learn more about PTMs related to IRAK2 Antibody (H00003656-M04).
 

Research Areas for IRAK2 Antibody (H00003656-M04)

Find related products by research area.

Blogs on IRAK2

There are no specific blogs for IRAK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IRAK2 Antibody (1A6) and receive a gift card or discount.

Bioinformatics

Gene Symbol IRAK2
Entrez
OMIM
Uniprot