Intersectin 1 Antibody - BSA Free

Western Blot: Intersectin 1 Antibody [NBP3-10417] - Western blot analysis of Intersectin 1 in Mouse Thymus. Antibody dilution at 1ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Intersectin 1 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Mouse Intersectin 1 (NP_001103746). Peptide sequence IPPSFRRVRSGSGMSVISSSSVDQRLPEEPSSEDEQQPEKKLPVTFEDKK
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ITSN1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 70 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Intersectin 1 Antibody - BSA Free

• 11
• intersectin 1 (SH3 domain protein)
• intersectin short variant 12
• intersectin-1
• ITSN
• SH3 domain protein-1A
• SH3 domain-containing protein 1A
• Src homology 3 domain-containing protein

Background

Intersectin 1 is an adapter protein that may provide an indirect link between the endocytic membrane traffic and the actin assembly machinery. It may regulate the formation of clathrin-coated vesicles. Isoform 1 could be involved in brain-specific synaptic vesicle recycling. Intersectin 1 is overexpressed in brain from Down syndrome foetuses suggesting a gene dosage-dependent contribution to the abnormalities of Down syndrome. Intersectin 1 interacts with dynamin, CDC42, SNAP25 and SNAP23. It clusters several dynamin in a manner that is regulated by alternative splicing. Intersectin 1 also binds clathrin-associated proteins and other components of the endocytic machinery, such as SPIN90, EPS15, EPN1, EPN2 and STN2. Adapter protein that may provide indirect link between the endocytic membrane traffic and the actin assembly machinery. May regulate the formation of clathrin-coated vesicles. Isoform 1 could be involved in brain-specific synaptic vesicle recycling.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ITSN1