Recombinant Human Integrin beta 5 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Integrin beta 5 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 421 - 516 of Human ITGB5 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:TASFEVSLEARSCPSRHTEHVFALRPVGFRDSLEVGVTYNCTCGCSVGLEPNSARCNGSGTYVCGLCECSPGYLGTRCECQDGENQSVYQNLCREA

Protein/Peptide Type
Partial Recombinant Protein
Gene
ITGB5

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
20 mM Tris-HCl, 0.1M NaCl, pH 8.0, 2 mM dithiothreitol, 10% glycerol

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Integrin beta 5 Protein

  • FLJ26658
  • Integrin beta 5
  • integrin beta-5
  • integrin, beta 5
  • ITGB5

Background

ITGB5 - integrin, beta 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1342
Species: Hu, Mu, Rt, Bv
Applications: WB, Func, IA, IHC, IHC-Fr, IHC-P, IP
NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
BBA37
Species: Hu
Applications: AdBlk
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-03886
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-82991
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
NBP1-05987
Species: Hu, Mu, Rt
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NBP2-36561
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP
NBP2-27418
Species: Hu, Pm
Applications: WB
AF4076
Species: Mu, Rt
Applications: WB, Simple Western, Flow, CyTOF-ready, ICC
AF385
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
AF1219
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, CyTOF-ready, ICC
NBP1-85747
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P, IP
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
AF4259
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
H00003693-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Integrin beta 5 Partial Recombinant Protein (H00003693-Q01) (0)

There are no publications for Integrin beta 5 Partial Recombinant Protein (H00003693-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Integrin beta 5 Partial Recombinant Protein (H00003693-Q01) (0)

There are no reviews for Integrin beta 5 Partial Recombinant Protein (H00003693-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Integrin beta 5 Partial Recombinant Protein (H00003693-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Integrin beta 5 Products

Bioinformatics Tool for Integrin beta 5 Partial Recombinant Protein (H00003693-Q01)

Discover related pathways, diseases and genes to Integrin beta 5 Partial Recombinant Protein (H00003693-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Integrin beta 5 Partial Recombinant Protein (H00003693-Q01)

Discover more about diseases related to Integrin beta 5 Partial Recombinant Protein (H00003693-Q01).
 

Pathways for Integrin beta 5 Partial Recombinant Protein (H00003693-Q01)

View related products by pathway.

PTMs for Integrin beta 5 Partial Recombinant Protein (H00003693-Q01)

Learn more about PTMs related to Integrin beta 5 Partial Recombinant Protein (H00003693-Q01).
 

Research Areas for Integrin beta 5 Partial Recombinant Protein (H00003693-Q01)

Find related products by research area.

Blogs on Integrin beta 5

There are no specific blogs for Integrin beta 5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Integrin beta 5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGB5
Entrez