Recombinant Human integrin beta 4 binding protein GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human integrin beta 4 binding protein GST (N-Term) Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 245 of Human EIF6 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHASIAGCRIIGRMCVGNRHGLLVPNNTTDQELQHIRNSLPDTVQIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAQPSTIATSMRDSLIDSLT

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
EIF6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human integrin beta 4 binding protein GST (N-Term) Protein

  • B(2)GCN homolog
  • b(2)gcn
  • B4 integrin interactor
  • CAB
  • EIF3Ap27(BBP)
  • eIF-6
  • eukaryotic translation initiation factor 3A
  • eukaryotic translation initiation factor 6
  • ITGB4BPintegrin beta 4 binding protein
  • p27 beta-4 integrin-binding protein
  • p27BBP

Background

Hemidesmosomes are structures which link the basal lamina to the intermediate filament cytoskeleton. An important functional component of hemidesmosomes is the integrin beta-4 subunit (ITGB4), a protein containing two fibronectin type III domains. The protein encoded by this gene binds to the fibronectin type III domains of ITGB4 and may help link ITGB4 to the intermediate filament cytoskeleton. The encoded protein, which is insoluble and found both in the nucleus and in the cytoplasm, can function as a translation initiation factor and prevent the association of the 40S and 60S ribosomal subunits. Multiple transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

664-LI
Species: Hu
Applications: BA
DKK300
Species: Hu
Applications: ELISA
NBP1-88191
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NB600-919
Species: Hu, Mu
Applications: ELISA, IHC, IHC-Fr, IHC-P, WB
NBP1-90949
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-80616
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-03198
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB300-709
Species: Hu, Pm
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
NBP2-47561
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-13436
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90324
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00007536-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP1-86589
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF682
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, WB
NBP1-32920
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF4036
Species: Hu
Applications: Simple Western, WB
H00005324-M02
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
NBP2-13669
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-93302
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for integrin beta 4 binding protein Recombinant Protein (H00003692-P01) (0)

There are no publications for integrin beta 4 binding protein Recombinant Protein (H00003692-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for integrin beta 4 binding protein Recombinant Protein (H00003692-P01) (0)

There are no reviews for integrin beta 4 binding protein Recombinant Protein (H00003692-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for integrin beta 4 binding protein Recombinant Protein (H00003692-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional integrin beta 4 binding protein Products

Bioinformatics Tool for integrin beta 4 binding protein Recombinant Protein (H00003692-P01)

Discover related pathways, diseases and genes to integrin beta 4 binding protein Recombinant Protein (H00003692-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for integrin beta 4 binding protein Recombinant Protein (H00003692-P01)

Discover more about diseases related to integrin beta 4 binding protein Recombinant Protein (H00003692-P01).
 

Pathways for integrin beta 4 binding protein Recombinant Protein (H00003692-P01)

View related products by pathway.

PTMs for integrin beta 4 binding protein Recombinant Protein (H00003692-P01)

Learn more about PTMs related to integrin beta 4 binding protein Recombinant Protein (H00003692-P01).
 

Research Areas for integrin beta 4 binding protein Recombinant Protein (H00003692-P01)

Find related products by research area.

Blogs on integrin beta 4 binding protein

There are no specific blogs for integrin beta 4 binding protein, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human integrin beta 4 binding protein GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF6