integrin beta 4 binding protein Recombinant Protein Antigen

Images

 
There are currently no images for integrin beta 4 binding protein Protein (NBP2-13954PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

integrin beta 4 binding protein Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EIF6.

Source: E. coli

Amino Acid Sequence: LSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
EIF6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13954.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for integrin beta 4 binding protein Recombinant Protein Antigen

  • B(2)GCN homolog
  • b(2)gcn
  • B4 integrin interactor
  • CAB
  • EIF3Ap27(BBP)
  • eIF-6
  • eukaryotic translation initiation factor 3A
  • eukaryotic translation initiation factor 6
  • ITGB4BPintegrin beta 4 binding protein
  • p27 beta-4 integrin-binding protein
  • p27BBP

Background

Hemidesmosomes are structures which link the basal lamina to the intermediate filament cytoskeleton. An important functional component of hemidesmosomes is the integrin beta-4 subunit (ITGB4), a protein containing two fibronectin type III domains. The protein encoded by this gene binds to the fibronectin type III domains of ITGB4 and may help link ITGB4 to the intermediate filament cytoskeleton. The encoded protein, which is insoluble and found both in the nucleus and in the cytoplasm, can function as a translation initiation factor and prevent the association of the 40S and 60S ribosomal subunits. Multiple transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

664-LI
Species: Hu
Applications: BA
DKK300
Species: Hu
Applications: ELISA
NBP1-88191
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NB600-919
Species: Hu, Mu
Applications: ELISA, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-90949
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-80616
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-03198
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-26876
Species: Hu
Applications: IHC,  IHC-P
NBP2-47561
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-13436
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-90324
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
H00007536-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-86589
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
AF1445
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
NBP1-32920
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
AF4036
Species: Hu
Applications: Simple Western, WB
H00005324-M02
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, WB
NBP3-48658
Species: Ca, Fe, Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-93302
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P

Publications for integrin beta 4 binding protein Protein (NBP2-13954PEP) (0)

There are no publications for integrin beta 4 binding protein Protein (NBP2-13954PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for integrin beta 4 binding protein Protein (NBP2-13954PEP) (0)

There are no reviews for integrin beta 4 binding protein Protein (NBP2-13954PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for integrin beta 4 binding protein Protein (NBP2-13954PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional integrin beta 4 binding protein Products

Research Areas for integrin beta 4 binding protein Protein (NBP2-13954PEP)

Find related products by research area.

Blogs on integrin beta 4 binding protein

There are no specific blogs for integrin beta 4 binding protein, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our integrin beta 4 binding protein Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF6