Integrin beta 3/CD61 Antibody - BSA Free

Immunohistochemistry-Paraffin: Integrin beta 3/CD61 Antibody [NBP1-83453] - EFCAB13 Antibody [NBP1-83453] - Staining of human bone marrow shows strong cytoplasmic positivity in megakaryocytes.

Product Discontinued

Integrin beta 3/CD61 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGP
• Predicted Species: Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ITGB3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 30322915).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Integrin beta 3/CD61 Antibody - BSA Free

• CD61 antigen
• CD61
• GP3A
• GP3Aplatelet glycoprotein IIIa
• GPIIIA
• GPIIIaintegrin beta-3
• INGRB3
• Integrin beta 3
• integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61)
• ITG B3
• ITGB3
• Platelet membrane glycoprotein IIIa

Background

Platelet membrane glycoprotein Integrin beta-3 (GP IIIa) forms a Ca2+-dependent heterodimer complex with GP IIb. The GP IIb-IIIa complex constitutes the fibrinogen and fibronectin receptor on stimulated platelets. A biochemically and immunologically similar membrane glycoprotein complex is present on endothelial cells. Homology suggests that GP IIIa is a member of a family of cell-surface adhesion receptors. (1) Data provide further support for the key role of the cytoplasmic domain of the beta3 integrin in cell adhesion and suggest a potential role for the beta3C integrin subunit in modulating cell-matrix interactions (2). It has been demonstrated that the beta 3 subunit of alpha IIb beta 3 was phosphorylated on tyrosine residues in response to thrombin-induced platelet aggregation. Data suggest that tyrosine phosphorylation of an integrin beta subunit may be important in initiating outside-in signaling cascades by inducing association of signaling components directly with the integrin (3). be important in initiating outside-in signaling cascades by inducing association of signaling components directly with the integrin (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Integrin beta 3/CD61 Antibody (NBP1-83453)(1)

Publication using NBP1-83453

• Fei D, Zhen T, Durham B et al. Impaired hematopoiesis and leukemia development in mice with a conditional knock-in allele of a mutant splicing factor gene U2af1 Proc Natl Acad Sci U S A. [PMID: 30322915] (IF/IHC, Mouse)

Bioinformatics

• Gene Symbol: ITGB3