Integrin alpha D/CD11d Antibody

Images

 
Immunohistochemistry: Integrin alpha D/CD11d Antibody [NBP1-90237] - Staining of human bone marrow shows distinct cytoplasmic positivity in a subset of bone marrow poietic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Integrin alpha D/CD11d Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RCWEEKPSALEAGDATVCLTIQKSSLDQLGDIQSSVRFDLALDPGRLTSRAIFNETKNPTLTRRKTLGLGIHCETLKLLLPDCVEDVVSPIILHLNFSLV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ITGAD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH6 retrieval is recommended.
Control Peptide
Integrin alpha D/CD11d Protein (NBP1-90237PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Integrin alpha D/CD11d Antibody

  • ADB2
  • CD11 antigen-like family member D
  • CD11d
  • FLJ39841
  • Integrin alpha D
  • integrin alpha-D
  • integrin, alpha D
  • Leukointegrin Alpha D

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB500-328
Species: Hu
Applications: Flow, Func, IP, CyTOF-ready
NB110-97871
Species: Mu
Applications: Flow, IHC, IHC-P, IP, CyTOF-ready
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NBP2-46010
Species: Hu, Ca, Mk
Applications: WB, IHC, IF
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-84550
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-64843
Species: Mu
Applications: Flow, IHC, IHC-Fr
MAB6799
Species: Hu
Applications: WB, IHC
NBP1-90237
Species: Hu
Applications: IHC, IHC-P

Publications for Integrin alpha D/CD11d Antibody (NBP1-90237) (0)

There are no publications for Integrin alpha D/CD11d Antibody (NBP1-90237).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Integrin alpha D/CD11d Antibody (NBP1-90237) (0)

There are no reviews for Integrin alpha D/CD11d Antibody (NBP1-90237). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Integrin alpha D/CD11d Antibody (NBP1-90237) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Integrin alpha D/CD11d Antibody Products

Related Products by Gene

Bioinformatics Tool for Integrin alpha D/CD11d Antibody (NBP1-90237)

Discover related pathways, diseases and genes to Integrin alpha D/CD11d Antibody (NBP1-90237). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Integrin alpha D/CD11d Antibody (NBP1-90237)

Discover more about diseases related to Integrin alpha D/CD11d Antibody (NBP1-90237).
 

Pathways for Integrin alpha D/CD11d Antibody (NBP1-90237)

View related products by pathway.

PTMs for Integrin alpha D/CD11d Antibody (NBP1-90237)

Learn more about PTMs related to Integrin alpha D/CD11d Antibody (NBP1-90237).
 

Research Areas for Integrin alpha D/CD11d Antibody (NBP1-90237)

Find related products by research area.

Blogs on Integrin alpha D/CD11d

There are no specific blogs for Integrin alpha D/CD11d, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Integrin alpha D/CD11d Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGAD
Entrez
Uniprot

Customers Who Bought This Also Bought