Integrin alpha D/CD11d Antibody

Images

 
Immunohistochemistry: Integrin alpha D/CD11d Antibody [NBP1-90237] - Staining of human bone marrow shows distinct cytoplasmic positivity in a subset of bone marrow poietic cells.

Product Details

Summary
Reactivity Hu
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Order Details

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Purity
Immunogen affinity purified

Integrin alpha D/CD11d Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RCWEEKPSALEAGDATVCLTIQKSSLDQLGDIQSSVRFDLALDPGRLTSRAIFNETKNPTLTRRKTLGLGIHCETLKLLLPDCVEDVVSPIILHLNFSLV
Modification
No Modifications
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ITGAD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH6 retrieval is recommended.
Control Peptide
Integrin alpha D/CD11d Protein (NBP1-90237PEP)

Alternate Names for Integrin alpha D/CD11d Antibody

  • ADB2
  • CD11 antigen-like family member D
  • CD11d
  • FLJ39841
  • integrin alpha-D
  • integrin, alpha D
  • Leukointegrin Alpha D

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
AF1008
Species: Mu
Applications: WB, Flow, IHC
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB500-328
Species: Hu
Applications: Flow, Func, IP
NB110-97871
Species: Mu
Applications: Flow, IHC, IHC-P, IP
NBP2-46010
Species: Hu, Ca, Mk
Applications: WB, IHC, IF
NB100-524
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-84550
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24867
Species: Hu
Applications: Flow, Func, In vitro, In vivo, Flow-CS
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-64843
Species: Mu
Applications: Flow, IHC, IHC-Fr
MAB6799
Species: Hu
Applications: WB, IHC

Publications for Integrin alpha D/CD11d Antibody (NBP1-90237) (0)

There are no publications for Integrin alpha D/CD11d Antibody (NBP1-90237).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Integrin alpha D/CD11d Antibody (NBP1-90237) (0)

There are no reviews for Integrin alpha D/CD11d Antibody (NBP1-90237). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Integrin alpha D/CD11d Antibody (NBP1-90237) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Integrin alpha D/CD11d Antibody Products

Related Products by Gene

Bioinformatics Tool for Integrin alpha D/CD11d Antibody (NBP1-90237)

Discover related pathways, diseases and genes to Integrin alpha D/CD11d Antibody (NBP1-90237). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Integrin alpha D/CD11d Antibody (NBP1-90237)

Discover more about diseases related to Integrin alpha D/CD11d Antibody (NBP1-90237).
 

Pathways for Integrin alpha D/CD11d Antibody (NBP1-90237)

View related products by pathway.

PTMs for Integrin alpha D/CD11d Antibody (NBP1-90237)

Learn more about PTMs related to Integrin alpha D/CD11d Antibody (NBP1-90237).
 

Research Areas for Integrin alpha D/CD11d Antibody (NBP1-90237)

Find related products by research area.

Blogs on Integrin alpha D/CD11d

There are no specific blogs for Integrin alpha D/CD11d, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol ITGAD
Entrez
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-90237 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought