Integrin alpha 4/CD49d Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related Integrin alpha 4/CD49d Peptides and Proteins

Order Details


    • Catalog Number
      NBP2-55907PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Integrin alpha 4/CD49d Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Integrin alpha 4/CD49d.

Source: E. coli

Amino Acid Sequence: RLLYCIKADPHCLNFLCNFGKMESGKEASVHIQLEGRPSILEMDETSALKFEIRATGFPEPNPRVIELNKDENVAHVLLEGLHHQRPKR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ITGA4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55907.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Integrin alpha 4/CD49d Recombinant Protein Antigen

  • 269C wild type
  • CD49 antigen-like family member D
  • CD49d antigen
  • CD49d
  • CD49Dantigen CD49D, alpha-4 subunit of VLA-4 receptor
  • IA4
  • Integrin alpha 4
  • integrin alpha-4 subunit
  • integrin alpha-4
  • Integrin alpha-IV
  • integrin, alpha 4 (antigen CD49D, alpha 4 subunit of VLA-4 receptor)
  • ITGA4
  • MGC90518
  • very late activation protein 4 receptor, alpha 4 subunit
  • VLA-4 subunit alpha
  • VLA-4

Background

VLA-4 is a cell surface heterodimer in the integrin superfamily of adhesion receptors. Anti-VLA-4 antibodies inhibited cytolytic T cell activity, with inhibitory activity directed against the effector T cells rather than their targets. Thus, whereas other VLA receptors appear to mediate cell--matrix interactions, VLA-4 may have a cell--cell adhesion function. Alpha 4 stands apart from all other known integrin alpha subunit sequences because (i) alpha 4 has neither an inserted I-domain, nor a disulfide-linked C-terminal fragment, (ii) its sequence is the most unique and (iii) only alpha 4 has a potential protease cleavage site, near the middle of the coding region, which appears responsible for the characteristic 80,000 and 70,000 Mr fragments of alpha 4 (1). Unlike any other integrin alpha subunit, the intact (150 kDa) alpha 4 subunit of VLA-4 can sometimes be cleaved into two noncovalently associated fragments (80 and 70 kDa) (2). The VLA-4 integrins are indispensable for embryogenesis, haematopoiesis and immune responses, possibly because alpha4 regulates cellular functions differently from other integrins through its cytoplasmic tail (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB3595
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
AF1730
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
AF796
Species: Mu
Applications: AdBlk, IHC, WB
7268-CT
Species: Hu
Applications: BA
MAB17781
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
BBA24
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow
AF629
Species: Hu
Applications: CyTOF-ready, Flow, InhibCellGro, WB
NB110-89474
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, ISH, Simple Western, Single-Cell Western, WB
BBA10
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-84576
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
AF4117
Species: Rt
Applications: IHC, WB
DVC00
Species: Hu
Applications: ELISA
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF114
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
AF3628
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP2-55907PEP
Species: Hu
Applications: AC

Publications for Integrin alpha 4/CD49d Recombinant Protein Antigen (NBP2-55907PEP) (0)

There are no publications for Integrin alpha 4/CD49d Recombinant Protein Antigen (NBP2-55907PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Integrin alpha 4/CD49d Recombinant Protein Antigen (NBP2-55907PEP) (0)

There are no reviews for Integrin alpha 4/CD49d Recombinant Protein Antigen (NBP2-55907PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Integrin alpha 4/CD49d Recombinant Protein Antigen (NBP2-55907PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Integrin alpha 4/CD49d Products

Research Areas for Integrin alpha 4/CD49d Recombinant Protein Antigen (NBP2-55907PEP)

Find related products by research area.

Blogs on Integrin alpha 4/CD49d

There are no specific blogs for Integrin alpha 4/CD49d, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Integrin alpha 4/CD49d Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGA4