Integrin alpha 3/CD49c Antibody (29A3) [DyLight 680]

• Reactivity: Hu, Po
• Applications: WB, ICC/IF, IHC
• Clone: 29A3
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: DyLight 680

Integrin alpha 3/CD49c Antibody (29A3) [DyLight 680] Summary

• Description: This conjugate is made on demand and is not held in inventory. Each order represents a unique lot. All conjugates are generated using validated conjugation protocols and meet strict degree of labeling (F/P) specifications; additional information is available upon request. The antibody concentration is provided on the individual product label.
  
  For specialized conjugation needs, like large quantities, specific concentrations, and defined F/P ratios, bulk and custom antibody conjugation services are available.
• Immunogen: Derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the Integrin alpha 3/CD49c including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.
• Specificity: This antibody recognizes specifically the cytoplasmic domain of Integrin alpha 3/CD49c which is present in the basal cell layer in skin, glomeruli, Bowman's capsules and distal tubuli in kidney, all vascular and capillary endothelia in brain, heart and skin, and vascular smooth muscle cells in heart.
• Isotype: IgG1
• Clonality: Monoclonal
• Host: Mouse
• Gene: ITGA3
• Purity: Protein A or G purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Frozen
  • Western Blot
• Application Notes: Recommended applications are based on validated applications from the unconjugated base product NBP1-97692. This conjugated antibody is not kept in inventory and is made to order using validated conjugation protocols.

Reactivity Notes

A broad species reactivity is expected based on the conserved nature of the epitope. Use in Porcine reported in scientific literature (PMID:32211117).

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Protein A or G purified

Notes

DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

Alternate Names for Integrin alpha 3/CD49c Antibody (29A3) [DyLight 680]

• antigen identified by monoclonal J143
• CD49 antigen-like family member C
• CD49c antigen
• CD49c
• FLJ34631
• FLJ34704
• FRP-2
• Galactoprotein B3
• GAP-B3
• GAPB3CD49C
• Integrin alpha 3
• integrin alpha-3
• integrin, alpha 3 (antigen CD49C, alpha 3 subunit of VLA-3 receptor)
• ITGA3
• MSK18
• VCA-2
• very late activation protein 3 receptor, alpha-3 subunit
• VL3A
• VLA-3 subunit alpha
• VLA3a

Background

Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. Alpha chain 3 undergoes post-translational cleavage in the extracellular domain to yield disulfide-linked light and heavy chains that join with beta 1 to form an integrin that interacts with many extracellular-matrix proteins. The alpha 3 beta 1 integrin is known variously as: very late (activation) antigen 3 (VLA3), very common antigen 2 (VCA2), extracellular matrix receptor 1 (ECMR1), and galactoprotein b3 (GAPB3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ITGA3