Integrin alpha 3/CD49c Antibody (29A3) [Alexa Fluor® 700]

Images

 
There are currently no images for Integrin alpha 3/CD49c Antibody (NBP1-97692AF700).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity Hu, PoSpecies Glossary
Applications WB, ICC/IF, IHC
Clone
29A3
Clonality
Monoclonal
Host
Mouse
Conjugate
Alexa Fluor 700

Order Details

Integrin alpha 3/CD49c Antibody (29A3) [Alexa Fluor® 700] Summary

Immunogen
Derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the Integrin alpha 3/CD49c including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.
Specificity
This antibody recognizes specifically the cytoplasmic domain of Integrin alpha 3/CD49c which is present in the basal cell layer in skin, glomeruli, Bowman's capsules and distal tubuli in kidney, all vascular and capillary endothelia in brain, heart and skin, and vascular smooth muscle cells in heart.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
ITGA3
Purity
Protein A or G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Frozen
  • Western Blot
Application Notes
Optimal dilution of this antibody should be experimentally determined..

Reactivity Notes

A broad species reactivity is expected based on the conserved nature of the epitope. Use in Porcine reported in scientific literature (PMID:32211117).

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Protein A or G purified

Notes

Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for Integrin alpha 3/CD49c Antibody (29A3) [Alexa Fluor® 700]

  • antigen identified by monoclonal J143
  • CD49 antigen-like family member C
  • CD49c antigen
  • CD49c
  • FLJ34631
  • FLJ34704
  • FRP-2
  • Galactoprotein B3
  • GAP-B3
  • GAPB3CD49C
  • Integrin alpha 3
  • integrin alpha-3
  • integrin, alpha 3 (antigen CD49C, alpha 3 subunit of VLA-3 receptor)
  • ITGA3
  • MSK18
  • VCA-2
  • very late activation protein 3 receptor, alpha-3 subunit
  • VL3A
  • VLA-3 subunit alpha
  • VLA3a

Background

Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. Alpha chain 3 undergoes post-translational cleavage in the extracellular domain to yield disulfide-linked light and heavy chains that join with beta 1 to form an integrin that interacts with many extracellular-matrix proteins. The alpha 3 beta 1 integrin is known variously as: very late (activation) antigen 3 (VLA3), very common antigen 2 (VCA2), extracellular matrix receptor 1 (ECMR1), and galactoprotein b3 (GAPB3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1864
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, Simple Western, WB
AF796
Species: Mu
Applications: AdBlk, IHC, WB
MAB17781
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
7268-CT
Species: Hu
Applications: BA
MAB1233
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IP
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NBP1-77333
Species: Hu, I, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
AF1730
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
MAB3595
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
MAB2528
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC, IP
BBA10
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
BBA24
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow
AF1172
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP2-67416
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB110-89474
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Simple Western, Single-Cell Western, WB
NBP1-97692AF700
Species: Hu, Po
Applications: WB, ICC/IF, IHC

Publications for Integrin alpha 3/CD49c Antibody (NBP1-97692AF700) (0)

There are no publications for Integrin alpha 3/CD49c Antibody (NBP1-97692AF700).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Integrin alpha 3/CD49c Antibody (NBP1-97692AF700) (0)

There are no reviews for Integrin alpha 3/CD49c Antibody (NBP1-97692AF700). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Integrin alpha 3/CD49c Antibody (NBP1-97692AF700) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Integrin alpha 3/CD49c Antibody (29A3) [Alexa Fluor® 700] and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGA3