Integrin alpha 2b/CD41 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ITGA2B. Source: E. coli
Amino Acid Sequence: FGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNV Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
ITGA2B |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84580.It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
24 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Integrin alpha 2b/CD41 Recombinant Protein Antigen
Background
Integrin alpha 2b (CD41) is a calcium-dependent, noncovalently associated heterodimer and contains a heavy chain (GPIIb alpha) and a light chain (GPIIb beta) linked by a single disulfide bond. The Integrin alpha 2B chain interacts with the Integrin beta 3 subunit/CD61 to form the platelet glycoprotein complex, gpIIb/IIIa. It is expressed on platelets and megakaryocytes. Ligands for the gpIIb/IIIa heterodimer include fibrinogen, von Willebrand factor, fibronectin, vitronectin, and thrombospondin. The gpIIb/IIIa complex is the major Integrin on platelets and is important for platelet adhesion and aggregation.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ca, Fe, Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Rt
Applications: IHC, WB
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: IHC, IHC-P, WB
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: AC
Publications for Integrin alpha 2b/CD41 Recombinant Protein Antigen (NBP1-84580PEP) (0)
There are no publications for Integrin alpha 2b/CD41 Recombinant Protein Antigen (NBP1-84580PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Integrin alpha 2b/CD41 Recombinant Protein Antigen (NBP1-84580PEP) (0)
There are no reviews for Integrin alpha 2b/CD41 Recombinant Protein Antigen (NBP1-84580PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Integrin alpha 2b/CD41 Recombinant Protein Antigen (NBP1-84580PEP) (0)
Additional Integrin alpha 2b/CD41 Products
Research Areas for Integrin alpha 2b/CD41 Recombinant Protein Antigen (NBP1-84580PEP)
Find related products by research area.
|
Blogs on Integrin alpha 2b/CD41