INSIG-2 Antibody

Images

 
Western Blot: INSIG-2 Antibody [NBP1-60007] - Titration: 0.2-1 ug/ml, Positive Control: Human brain.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

INSIG-2 Antibody Summary

Immunogen
Synthetic peptides corresponding to INSIG2(insulin induced gene 2) The peptide sequence was selected from the N terminal of INSIG2. Peptide sequence MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQ.
Clonality
Polyclonal
Host
Rabbit
Gene
INSIG2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against INSIG2 and was validated on Western blot.

The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for INSIG-2 Antibody

  • INSIG2 membrane protein
  • INSIG-2
  • insulin induced gene 2
  • insulin induced protein 2
  • insulin-induced gene 2 protein
  • MGC26273

Background

INSIG2 is highly similar to the protein product encoded by gene INSIG1. Both INSIG1 protein and this protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element binding proteins (SREBPs) by binding to SREBP cleavage-activating protein (SCAP), and thus prevent SCAP from escorting SREBPs to the Golgi.The protein encoded by this gene is highly similar to the protein product encoded by gene INSIG1. Both INSIG1 protein and this protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element binding proteins (SREBPs) by binding to SREBP cleavage-activating protein (SCAP), and thus prevent SCAP from escorting SREBPs to the Golgi. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-55244
Species: Hu, Rt
Applications: WB, ICC/IF
NB110-55244
Species: Hu, Rt
Applications: WB, ICC/IF
NB600-582
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha
Applications: WB, Simple Western
NBP2-01828
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-91996
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB110-60935
Species: Hu, Mu, Pm
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NB120-19481
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Ha
Applications: WB, IHC, IHC-P
NBP2-41103
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-42632
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-15374
Species: Hu
Applications: WB, Func, IHC, IHC-P, In vitro
NBP1-54446
Species: Hu, Ch
Applications: WB, ELISA, GS, ICC/IF, IP
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-15564
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for INSIG-2 Antibody (NBP1-60007) (0)

There are no publications for INSIG-2 Antibody (NBP1-60007).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for INSIG-2 Antibody (NBP1-60007) (0)

There are no reviews for INSIG-2 Antibody (NBP1-60007). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for INSIG-2 Antibody (NBP1-60007) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional INSIG-2 Antibody Products

Related Products by Gene

Bioinformatics Tool for INSIG-2 Antibody (NBP1-60007)

Discover related pathways, diseases and genes to INSIG-2 Antibody (NBP1-60007). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for INSIG-2 Antibody (NBP1-60007)

Discover more about diseases related to INSIG-2 Antibody (NBP1-60007).
 

Pathways for INSIG-2 Antibody (NBP1-60007)

View related products by pathway.

PTMs for INSIG-2 Antibody (NBP1-60007)

Learn more about PTMs related to INSIG-2 Antibody (NBP1-60007).

Blogs on INSIG-2.

SREBP: Gatekeeper of Cholesterol Homeostasis
SREBP1 (sterol-regulatory-element-binding protein 2) is a basic-helix-loop-helix-leucine zipper (bHLH-ZIP) transcription factor. It regulates sterol and cholesterol homeostasis by controlling enzymes involved in cholesterol synthesis and uptake, e.g....  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our INSIG-2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol INSIG2
Uniprot

Customers Who Bought This Also Bought