INSIG-2 Antibody


Western Blot: INSIG-2 Antibody [NBP1-60007] - Titration: 0.2-1 ug/ml, Positive Control: Human brain.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

INSIG-2 Antibody Summary

Synthetic peptides corresponding to INSIG2(insulin induced gene 2) The peptide sequence was selected from the N terminal of INSIG2. Peptide sequence MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQ.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against INSIG2 and was validated on Western blot.

The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for INSIG-2 Antibody

  • INSIG2 membrane protein
  • INSIG-2
  • insulin induced gene 2
  • insulin induced protein 2
  • insulin-induced gene 2 protein
  • MGC26273


INSIG2 is highly similar to the protein product encoded by gene INSIG1. Both INSIG1 protein and this protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element binding proteins (SREBPs) by binding to SREBP cleavage-activating protein (SCAP), and thus prevent SCAP from escorting SREBPs to the Golgi.The protein encoded by this gene is highly similar to the protein product encoded by gene INSIG1. Both INSIG1 protein and this protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element binding proteins (SREBPs) by binding to SREBP cleavage-activating protein (SCAP), and thus prevent SCAP from escorting SREBPs to the Golgi. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB, ICC/IF
Species: Hu, Rt
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha
Applications: WB, Simple Western
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Pm
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu
Applications: WB, Func, IHC, IHC-P, In vitro
Species: Hu, Ch
Applications: WB, ELISA, GS, ICC/IF, IP
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB

Publications for INSIG-2 Antibody (NBP1-60007) (0)

There are no publications for INSIG-2 Antibody (NBP1-60007).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for INSIG-2 Antibody (NBP1-60007) (0)

There are no reviews for INSIG-2 Antibody (NBP1-60007). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for INSIG-2 Antibody (NBP1-60007) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional INSIG-2 Antibody Products

Related Products by Gene

Bioinformatics Tool for INSIG-2 Antibody (NBP1-60007)

Discover related pathways, diseases and genes to INSIG-2 Antibody (NBP1-60007). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for INSIG-2 Antibody (NBP1-60007)

Discover more about diseases related to INSIG-2 Antibody (NBP1-60007).

Pathways for INSIG-2 Antibody (NBP1-60007)

View related products by pathway.

PTMs for INSIG-2 Antibody (NBP1-60007)

Learn more about PTMs related to INSIG-2 Antibody (NBP1-60007).

Blogs on INSIG-2.

SREBP: Gatekeeper of Cholesterol Homeostasis
SREBP1 (sterol-regulatory-element-binding protein 2) is a basic-helix-loop-helix-leucine zipper (bHLH-ZIP) transcription factor. It regulates sterol and cholesterol homeostasis by controlling enzymes involved in cholesterol synthesis and uptake, e.g....  Read full blog post.

Contact Information

Product PDFs

Review this Product

Be the first to review our INSIG-2 Antibody and receive a gift card or discount.


Gene Symbol INSIG2

Customers Who Bought This Also Bought