INSIG-2 Antibody


Western Blot: INSIG-2 Antibody [NBP1-59687] - Sample Type: 721_B Antibody Dilution: 1.0 ug/ml INSIG2 is supported by BioGPS gene expression data to be expressed in 721_B
Western Blot: INSIG-2 Antibody [NBP1-59687] - Human Muscle lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity Hu, Rt, Mu, Po, Bv, Ca, Eq, Gt, Gp, Rb, ShSpecies Glossary
Applications WB

Order Details

INSIG-2 Antibody Summary

Synthetic peptides corresponding to INSIG2(insulin induced gene 2) The peptide sequence was selected from the middle region of INSIG2. Peptide sequence WWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINH. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Porcine (100%), Rabbit (100%), Guinea Pig (93%), Bovine (100%), Canine (100%), Goat (100%), Sheep (100%), Equine (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against INSIG2 and was validated on Western blot.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Read Publication using
NBP1-59687 in the following applications:

  • WB
    1 publication

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 23280554).

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for INSIG-2 Antibody

  • INSIG2 membrane protein
  • INSIG-2
  • insulin induced gene 2
  • insulin induced protein 2
  • insulin-induced gene 2 protein
  • MGC26273


Oxysterols regulate cholesterol homeostasis through the liver X receptor (LXR)- and sterol regulatory element-binding protein (SREBP)-mediated signaling pathways. This gene is an insulin-induced gene. INSIG1 is an endoplasmic reticulum (ER) membrane protein that plays a critical role in regulating cholesterol concentrations in cells. INSIG1 binds to the sterol-sensing domains of SREBP cleavage-activating protein (SCAP) and HMG CoA reductase, and is essential for the sterol-mediated trafficking of the two proteins.The protein encoded by this gene is highly similar to the protein product encoded by gene INSIG1. Both INSIG1 protein and this protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element binding proteins (SREBPs) by binding to SREBP cleavage-activating protein (SCAP), and thus prevent SCAP from escorting SREBPs to the Golgi. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB, ICC/IF
Species: Hu, Rt
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha, Pm
Applications: WB, Simple Western, IHC-Fr, KO
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IP
Species: Hu, Mu, Ch, Pm
Applications: WB, IB, IHC
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu
Applications: WB, Func, IHC, IHC-P, In vitro
Species: Hu, Ch
Applications: WB, ELISA, GS, ICC/IF, IP
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P, ICC
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
Species: Hu, Rt, Mu, Po, Bv, Ca, Eq, Gt, Gp, Rb, Sh
Applications: WB

Publications for INSIG-2 Antibody (NBP1-59687)(1)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for INSIG-2 Antibody (NBP1-59687) (0)

There are no reviews for INSIG-2 Antibody (NBP1-59687). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for INSIG-2 Antibody (NBP1-59687) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional INSIG-2 Products

Bioinformatics Tool for INSIG-2 Antibody (NBP1-59687)

Discover related pathways, diseases and genes to INSIG-2 Antibody (NBP1-59687). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for INSIG-2 Antibody (NBP1-59687)

Discover more about diseases related to INSIG-2 Antibody (NBP1-59687).

Pathways for INSIG-2 Antibody (NBP1-59687)

View related products by pathway.

PTMs for INSIG-2 Antibody (NBP1-59687)

Learn more about PTMs related to INSIG-2 Antibody (NBP1-59687).

Blogs on INSIG-2.

SREBP: Gatekeeper of Cholesterol Homeostasis
SREBP1 (sterol-regulatory-element-binding protein 2) is a basic-helix-loop-helix-leucine zipper (bHLH-ZIP) transcription factor. It regulates sterol and cholesterol homeostasis by controlling enzymes involved in cholesterol synthesis and uptake, e.g....  Read full blog post.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our INSIG-2 Antibody and receive a gift card or discount.


Gene Symbol INSIG2