Reactivity | Hu, Rt, Mu, Po, Bv, Ca, Eq, Gt, Gp, Rb, ShSpecies Glossary |
Applications | WB |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | Synthetic peptides corresponding to INSIG2(insulin induced gene 2) The peptide sequence was selected from the middle region of INSIG2. Peptide sequence WWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINH. The peptide sequence for this immunogen was taken from within the described region. |
Predicted Species | Mouse (100%), Porcine (100%), Rabbit (100%), Guinea Pig (93%), Bovine (100%), Canine (100%), Goat (100%), Sheep (100%), Equine (100%). Backed by our 100% Guarantee. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | INSIG2 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Application Notes | This is a rabbit polyclonal antibody against INSIG2 and was validated on Western blot. |
|
Theoretical MW | 25 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
Publications |
|
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS & 2% Sucrose. |
Preservative | 0.09% Sodium Azide |
Purity | Immunogen affinity purified |
Publication using NBP1-59687 | Applications | Species |
---|---|---|
Segatto M, Di Giovanni AL, Marino M, Pallottini V. Analysis of the protein network of cholesterol homeostasis in different brain regions: an age and sex dependent perspective J Cell Physiol 2012 Dec 31 [PMID: 23280554] (WB, Rat) | WB | Rat |
Secondary Antibodies |
Isotype Controls |
Diseases for INSIG-2 Antibody (NBP1-59687)Discover more about diseases related to INSIG-2 Antibody (NBP1-59687).
| Pathways for INSIG-2 Antibody (NBP1-59687)View related products by pathway.
|
PTMs for INSIG-2 Antibody (NBP1-59687)Learn more about PTMs related to INSIG-2 Antibody (NBP1-59687).
|
SREBP: Gatekeeper of Cholesterol Homeostasis SREBP1 (sterol-regulatory-element-binding protein 2) is a basic-helix-loop-helix-leucine zipper (bHLH-ZIP) transcription factor. It regulates sterol and cholesterol homeostasis by controlling enzymes involved in cholesterol synthesis and uptake, e.g.... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.