INSIG-2 Antibody

Western Blot: INSIG-2 Antibody [NBP1-59687] - Sample Type: 721_B Antibody Dilution: 1.0 ug/ml INSIG2 is supported by BioGPS gene expression data to be expressed in 721_B

Western Blot: INSIG-2 Antibody [NBP1-59687] - Human Muscle lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu, Rt, Mu, Po, Bv, Ca, Eq, Gt, Gp, Rb, Sh
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

INSIG-2 Antibody Summary

• Immunogen: Synthetic peptides corresponding to INSIG2(insulin induced gene 2) The peptide sequence was selected from the middle region of INSIG2. Peptide sequence WWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINH. The peptide sequence for this immunogen was taken from within the described region.
• Predicted Species: Mouse (100%), Porcine (100%), Rabbit (100%), Guinea Pig (93%), Bovine (100%), Canine (100%), Goat (100%), Sheep (100%), Equine (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: INSIG2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.2-1 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against INSIG2 and was validated on Western blot.
• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 23280554).

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS & 2% Sucrose.
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for INSIG-2 Antibody

• INSIG2 membrane protein
• INSIG-2
• insulin induced gene 2
• insulin induced protein 2
• insulin-induced gene 2 protein
• MGC26273

Background

Oxysterols regulate cholesterol homeostasis through the liver X receptor (LXR)- and sterol regulatory element-binding protein (SREBP)-mediated signaling pathways. This gene is an insulin-induced gene. INSIG1 is an endoplasmic reticulum (ER) membrane protein that plays a critical role in regulating cholesterol concentrations in cells. INSIG1 binds to the sterol-sensing domains of SREBP cleavage-activating protein (SCAP) and HMG CoA reductase, and is essential for the sterol-mediated trafficking of the two proteins.The protein encoded by this gene is highly similar to the protein product encoded by gene INSIG1. Both INSIG1 protein and this protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element binding proteins (SREBPs) by binding to SREBP cleavage-activating protein (SCAP), and thus prevent SCAP from escorting SREBPs to the Golgi. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for INSIG-2 Antibody (NBP1-59687)(1)

Publication using NBP1-59687

• Segatto M, Di Giovanni AL, Marino M, Pallottini V. Analysis of the protein network of cholesterol homeostasis in different brain regions: an age and sex dependent perspective J Cell Physiol 2012 Dec 31 [PMID: 23280554] (WB, Rat)

Bioinformatics

• Gene Symbol: INSIG2
• Uniprot:
  • Q9Y5U4(Human)