Inositol Monophosphatase 3/IMPAD1 Antibody

Images

 
Western Blot: IMPAD1 Antibody [NBP1-83655] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: IMPAD1 Antibody [NBP1-83655] - Immunohistochemical staining of human prostate shows strong cytoplasmic positivity with granular pattern in glandular cells.

Product Details

Summary
Reactivity Hu, Mouse, RatSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

Inositol Monophosphatase 3/IMPAD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NVLHEKSKGKTREGAEDKMTSGDVLSNRKMFYLLKTAFPSVQINTEEHVDAADQEVILWDHKIPEDILKEVTTPKEVPAESVTVWIDPLDATQEYTEDLRKYVTTMVCVAVNGK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IMPAD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
Inositol Monophosphatase 3/IMPAD1 Protein (NBP1-83655PEP)

Alternate Names for Inositol Monophosphatase 3/IMPAD1 Antibody

  • EC 3.1.3
  • EC 3.1.3.25
  • FLJ20421
  • IMP 3
  • IMP3
  • IMPA3
  • IMPA3IMPase 3
  • IMPase 3
  • inositol monophosphatase 3
  • Inositol Monophosphatase 3/IMPAD1
  • inositol monophosphatase domain containing 1
  • Inositol monophosphatase domain-containing protein 1
  • Inositol-1(or 4)-monophosphatase 3
  • Myo-inositol monophosphatase A3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83108
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32276
Species: Hu
Applications: WB, IP
NBP2-02627
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84339
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57229
Species: Hu
Applications: WB, IHC
NBP1-87512
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83107
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59510
Species: Hu
Applications: WB, IHC, IHC-P
MAB6240
Species: Hu
Applications: WB, IHC
NBP1-87345
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87343
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-24643
Species: Mu
Applications: WB
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NBP1-36999
Species: Hu, Mu, Rt
Applications: PEP-ELISA
NBP2-38621
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
NBP1-83655
Species: Hu, Mouse, Rat
Applications: WB, IHC, IHC-P

Publications for Inositol Monophosphatase 3/IMPAD1 Antibody (NBP1-83655) (0)

There are no publications for Inositol Monophosphatase 3/IMPAD1 Antibody (NBP1-83655).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Inositol Monophosphatase 3/IMPAD1 Antibody (NBP1-83655) (0)

There are no reviews for Inositol Monophosphatase 3/IMPAD1 Antibody (NBP1-83655). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Inositol Monophosphatase 3/IMPAD1 Antibody (NBP1-83655) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Inositol Monophosphatase 3/IMPAD1 Products

Related Products by Gene

Bioinformatics Tool for Inositol Monophosphatase 3/IMPAD1 Antibody (NBP1-83655)

Discover related pathways, diseases and genes to Inositol Monophosphatase 3/IMPAD1 Antibody (NBP1-83655). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Inositol Monophosphatase 3/IMPAD1 Antibody (NBP1-83655)

Discover more about diseases related to Inositol Monophosphatase 3/IMPAD1 Antibody (NBP1-83655).
 

Pathways for Inositol Monophosphatase 3/IMPAD1 Antibody (NBP1-83655)

View related products by pathway.

Research Areas for Inositol Monophosphatase 3/IMPAD1 Antibody (NBP1-83655)

Find related products by research area.

Blogs on Inositol Monophosphatase 3/IMPAD1

There are no specific blogs for Inositol Monophosphatase 3/IMPAD1, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol IMPAD1
Entrez

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-83655 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought