Inositol Monophosphatase 3/IMPAD1 Antibody

Images

 
Western Blot: IMPAD1 Antibody [NBP1-83655] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: IMPAD1 Antibody [NBP1-83655] - Staining of human prostate shows strong cytoplasmic positivity with granular pattern in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Inositol Monophosphatase 3/IMPAD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NVLHEKSKGKTREGAEDKMTSGDVLSNRKMFYLLKTAFPSVQINTEEHVDAADQEVILWDHKIPEDILKEVTTPKEVPAESVTVWIDPLDATQEYTEDLRKYVTTMVCVAVNGK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IMPAD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
Inositol Monophosphatase 3/IMPAD1 Protein (NBP1-83655PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Inositol Monophosphatase 3/IMPAD1 Antibody

  • EC 3.1.3
  • EC 3.1.3.25
  • FLJ20421
  • IMP 3
  • IMP3
  • IMPA3
  • IMPA3IMPase 3
  • IMPAD1
  • IMPase 3
  • inositol monophosphatase 3
  • inositol monophosphatase domain containing 1
  • Inositol monophosphatase domain-containing protein 1
  • Inositol-1(or 4)-monophosphatase 3
  • Myo-inositol monophosphatase A3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83108
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32276
Species: Hu
Applications: WB, IP
NBP2-02627
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84339
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59475
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-87512
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83107
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55073
Species: Hu
Applications: WB, ICC/IF
MAB6240
Species: Hu
Applications: WB, IHC
NBP1-87345
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87343
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NBP1-36999
Species: Hu, Mu, Rt
Applications: PEP-ELISA
NBP2-38621
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
NBP1-83655
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Inositol Monophosphatase 3/IMPAD1 Antibody (NBP1-83655) (0)

There are no publications for Inositol Monophosphatase 3/IMPAD1 Antibody (NBP1-83655).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Inositol Monophosphatase 3/IMPAD1 Antibody (NBP1-83655) (0)

There are no reviews for Inositol Monophosphatase 3/IMPAD1 Antibody (NBP1-83655). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Inositol Monophosphatase 3/IMPAD1 Antibody (NBP1-83655) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Inositol Monophosphatase 3/IMPAD1 Products

Related Products by Gene

Bioinformatics Tool for Inositol Monophosphatase 3/IMPAD1 Antibody (NBP1-83655)

Discover related pathways, diseases and genes to Inositol Monophosphatase 3/IMPAD1 Antibody (NBP1-83655). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Inositol Monophosphatase 3/IMPAD1 Antibody (NBP1-83655)

Discover more about diseases related to Inositol Monophosphatase 3/IMPAD1 Antibody (NBP1-83655).
 

Pathways for Inositol Monophosphatase 3/IMPAD1 Antibody (NBP1-83655)

View related products by pathway.

Research Areas for Inositol Monophosphatase 3/IMPAD1 Antibody (NBP1-83655)

Find related products by research area.

Blogs on Inositol Monophosphatase 3/IMPAD1

There are no specific blogs for Inositol Monophosphatase 3/IMPAD1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Inositol Monophosphatase 3/IMPAD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IMPAD1
Entrez

Customers Who Bought This Also Bought