Inhibin beta A Antibody

Images

 
Immunohistochemistry: Inhibin beta A Antibody [NBP1-87560] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Inhibin beta A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KKHILNMLHLKKRPDVTQPVPKAALLNAIRKLHVGKVGENGYVEIEDDIGRRAEMNELMEQTSEIITFAESGTARKTLHFEISKEGSDLSVVERAEVWLFLKVPKANRTRTKVTIRLFQQQKHPQGSLDTGEE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
INHBA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH6 retrieval is recommended.
Control Peptide
Inhibin beta A Protein (NBP1-87560PEP)
Publications
Read Publication using
NBP1-87560 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 26096938).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Inhibin beta A Antibody

  • Activin beta-A chain
  • beta A (activin A, activin AB alpha polypeptide)
  • EDF
  • erythroid differentiation factor
  • Erythroid differentiation protein
  • follicle-stimulating hormone-releasing protein
  • FRP
  • FSH-releasing protein
  • inhibin beta A chain
  • inhibin, beta A
  • Inhibin, beta-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
NBP2-01264
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87677
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13943
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56883
Species: Hu
Applications: IHC, IHC-P
NBP2-36489
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB110-89459
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P

Publications for Inhibin beta A Antibody (NBP1-87560)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Inhibin beta A Antibody (NBP1-87560) (0)

There are no reviews for Inhibin beta A Antibody (NBP1-87560). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Inhibin beta A Antibody (NBP1-87560) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Inhibin beta A Products

Bioinformatics Tool for Inhibin beta A Antibody (NBP1-87560)

Discover related pathways, diseases and genes to Inhibin beta A Antibody (NBP1-87560). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Inhibin beta A Antibody (NBP1-87560)

Discover more about diseases related to Inhibin beta A Antibody (NBP1-87560).
 

Pathways for Inhibin beta A Antibody (NBP1-87560)

View related products by pathway.

PTMs for Inhibin beta A Antibody (NBP1-87560)

Learn more about PTMs related to Inhibin beta A Antibody (NBP1-87560).
 

Research Areas for Inhibin beta A Antibody (NBP1-87560)

Find related products by research area.

Blogs on Inhibin beta A

There are no specific blogs for Inhibin beta A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Inhibin beta A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol INHBA
Entrez
Uniprot