Home » ING1 » ING1 Antibodies » ING1 Antibody

ING1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: ING1 Antibody [NBP2-57223] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunocytochemistry/ Immunofluorescence: ING1 Antibody [NBP2-57223] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ING1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VELFEAQQELGDTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNENRENASSNHDHDDGASGTPKEKKAKTSKKK
Specificity
Specificity of human ING1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ING1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ING1 Recombinant Protein Antigen (NBP2-57223PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ING1 Antibody

  • growth inhibitor ING1
  • growth inhibitory protein ING1
  • ING1
  • inhibitor of growth family, member 1
  • inhibitor of growth protein 1
  • p24ING1c
  • p33
  • p33ING1
  • p33ING1b
  • p47
  • p47ING1a
  • tumor suppressor ING1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NCF1 Antibody
NB100-790
Western Blot: NCF1 Antibody [NB100-790] - (1ug/ml) staining of Mouse Thymus (A) and Pig Spleen (B) lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: NCF1 Antibody [NB100-790] - (5ug/ml) staining of paraffin embedded Human Colon. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Western Blot: NCF1 Antibody [NB100-790] - Staining of U937 lysate (35 ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
(1 Publication)
Species: Hu, Mu, Po
Applications: WB, IHC-P, PEP-ELISA
Siglec-3/CD33
Antibody (44M12D3)
NBP2-22377
Western Blot: Siglec-3/CD33 Antibody (44M12D3) [NBP2-22377] - Analysis of CD33 in A) a partial recombinant protein and B) HCT-116 lysate using CD33 antibody at 2 ug/ml. goat anti-mouse Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Immunohistochemistry-Paraffin: Siglec-3/CD33 Antibody (44M12D3) [NBP2-22377] - Human lung tissue stained with CD33 antibody (3 ug/ml), peroxidase-conjugate and DAB chromogen. Note cytoplasmic and membrane staining.
Species: Hu
Applications: WB, IHC, IHC-P
Methionine
Aminopeptidase 2/META ...
AF3795
Western blot shows lysates of COLO 205 human colorectal adenocarcinoma cell line, LS180 human colorectal adenocarcinoma cell line, and HT‑29 human colon adenocarcinoma cell line. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human Methionine Aminopeptidase 2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3795) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Methionine Aminopeptidase 2 at approximately 70 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
(1 Publication)
Species: Hu
Applications: WB, IP
Syntaxin-BP1
Antibody
NBP1-83139
Western Blot: Syntaxin-BP1 Antibody [NBP1-83139] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/Immunofluorescence: Syntaxin-BP1 Antibody [NBP1-83139] - Immunofluorescent staining of human cell line SK-MEL-30 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: Syntaxin-BP1 Antibody [NBP1-83139] - Staining in human cerebral cortex and pancreas tissues using anti-STXBP1 antibody. Corresponding STXBP1 RNA-seq data are presented for the same tissues.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
CYBB/NOX2 Antibody
NBP2-41291
Western Blot: CYBB/NOX2 Antibody [NBP2-41291] - Western blot analysis of NOX2 in rat brain tissue lysate with NOX2 antibody at 1 ug/ml.
Immunocytochemistry/Immunofluorescence: CYBB/NOX2 Antibody [NBP2-41291] - Staining of NOX2 in rat brain tissue with NOX2 antibody at 20 ug/ml.
Immunohistochemistry-Paraffin: CYBB/NOX2 Antibody [NBP2-41291] - Staining of NOX2 in rat brain tissue cells with NOX2 antibody at 2 ug/ml.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Calcium-binding-protei
NBP1-33736
Western Blot: Calcium-binding-protein-P22 Antibody [NBP1-33736] - A. 50 ug mouse liver lysate/extract 12 % SDS-PAGE
Immunocytochemistry/Immunofluorescence: Calcium-binding-protein-P22 Antibody [NBP1-33736] - HepG2 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Calcium binding protein P22 protein stained by Calcium binding protein P22 antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: Calcium-binding-protein-P22 Antibody [NBP1-33736] - Paraffin-embedded mouse lung. Calcium binding protein P22 antibody dilution: 1:500.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Prohibitin 2
Antibody
NBP2-13754
Western Blot: Prohibitin 2 Antibody [NBP2-13754] - Analysis in human cell line BEWO.
Immunocytochemistry/Immunofluorescence: Prohibitin 2 Antibody [NBP2-13754] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Prohibitin 2 Antibody [NBP2-13754] - Staining of human colon shows moderate to strong cytoplasmic positivity in glandular cells.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
DYNC1H1 Antibody
NBP1-84254
Immunohistochemistry-Paraffin: DYNC1H1 Antibody [NBP1-84254] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: DYNC1H1 Antibody [NBP1-84254] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: DYNC1H1 Antibody [NBP1-84254] - Staining in human cerebral cortex and pancreas tissues using anti-DYNC1H1 antibody. Corresponding DYNC1H1 RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
DCTN3 Antibody
NBP1-91823
Immunocytochemistry/Immunofluorescence: DCTN3 Antibody [NBP1-91823] - Staining of human cell line A-431 shows localization to nucleoli & cytosol.
Immunohistochemistry-Paraffin: DCTN3 Antibody [NBP1-91823] - Staining of human pancreas shows distinct cytoplasmic positivity in exocrine glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - Analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti-p53 (PAb 240) [NB200-103] at a 1:200 dilution overnight at 4C and detected with an anti-mouse DyLight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(3 Reviews)
(22 Publications)
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
p21/CIP1/CDKN1A
Antibody (WA-1 (HJ21)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1 (HJ21)) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(11 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Akt phosphorylated at S473 was detected in immersion fixed paraffin-embedded sections of human breast cancer tissue using Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(19 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
TNF-alpha
[Unconjugated]
210-TA
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(21 Reviews)
(526 Publications)
Species: Hu
p63/TP73L Antibody
[Unconjugated]
AF1916
p63/TP73L was detected in immersion fixed paraffin-embedded sections of human breast using Goat Anti-Human p63/TP73L Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1916) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to nuclei. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
p63/TP73L was detected in immersion fixed SCC-25 human tongue carcinoma cell line using Goat Anti-Human p63/TP73L Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1916) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (yellow; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(3 Reviews)
Species: Hu
Applications: WB, IHC, ICC
GEF-H1 Antibody
NBP2-21577
Western Blot: GEF-H1 Antibody [NBP2-21577] - Immunoprecipitation of GEF-H1 protein from 293T whole cell extracts using 5 ug of GEF-H1 antibody. Western blot analysis was performed using GEF-H1 antibody. EasyBlot anti-Rabbit IgG was used as a secondary reagent.
Immunocytochemistry/Immunofluorescence: GEF-H1 Antibody [NBP2-21577] - HeLa cells were fixed in -20C 100% MeOH for 5 min. Green: ARHGEF2 protein stained by GEF-H1 antibody diluted at 1:500. Blue: Hoechst 33343 staining.
Immunohistochemistry-Paraffin: GEF-H1 Antibody [NBP2-21577] - Paraffin-embedded mouse testis. GEF-H1 antibody dilution: 1:500.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
RPSA Antibody
(JF0955)
NBP2-67117
Western Blot: RPSA Antibody (JF0955) [NBP2-67117] - Analysis of RPSA on different lysates using anti-RPSA antibody at 1/1,000 dilution. Positive control: Lane 1: K562 Lane 2: HepG2 Lane 3: A431
Immunocytochemistry/Immunofluorescence: RPSA Antibody (JF0955) [NBP2-67117] - Staining RPSA in RH-35 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: RPSA Antibody (JF0955) [NBP2-67117] - Analysis of paraffin-embedded mouse kidney tissue using anti-RPSA antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
PSMD7 Antibody
NBP2-38612
Western Blot: PSMD7 Antibody [NBP2-38612] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: PSMD7 Antibody [NBP2-38612] - Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: PSMD7 Antibody [NBP2-38612] - Staining of human cerebral cortex, colon, kidney and testis using Anti-PSMD7 antibody NBP2-38612 (A) shows similar protein distribution across tissues to independent antibody NBP2-38780 (B).
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
EBNA1BP2 Antibody
NBP1-84022
Western Blot: EBNA1BP2 Antibody [NBP1-84022] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/Immunofluorescence: EBNA1BP2 Antibody [NBP1-84022] - Staining of human cell line A-431 shows localization to nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: EBNA1BP2 Antibody [NBP1-84022] - Staining of human oral mucosa shows strong nuclear positivity in squamous epithelial cells.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ING1 Antibody (NBP2-57223) (0)

There are no publications for ING1 Antibody (NBP2-57223).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ING1 Antibody (NBP2-57223) (0)

There are no reviews for ING1 Antibody (NBP2-57223). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ING1 Antibody (NBP2-57223) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ING1 Antibody (NBP2-57223)

Discover related pathways, diseases and genes to ING1 Antibody (NBP2-57223). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ING1 Antibody (NBP2-57223)

Discover more about diseases related to ING1 Antibody (NBP2-57223).
 

Pathways for ING1 Antibody (NBP2-57223)

View related products by pathway.

PTMs for ING1 Antibody (NBP2-57223)

Learn more about PTMs related to ING1 Antibody (NBP2-57223).
 

Research Areas for ING1 Antibody (NBP2-57223)

Find related products by research area.

Blogs on ING1.

Check out the latest blog posts on ING1.
Understanding the Reasons for Histone H3 K4 Trimethylation (H3K4Me3)
Epigenetic mechanisms allow distinction between the active and inactive compartments of the genome, allowing proper cell lineage and embryogenesis. The trimethylation of Histone 3 at lysine 4 (H3K4Me3) is a common epigenetic histone modification that...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ING1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ING1