Home » ING1 » ING1 Antibodies » ING1 Antibody

ING1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: ING1 Antibody [NBP2-57223] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunocytochemistry/ Immunofluorescence: ING1 Antibody [NBP2-57223] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ING1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VELFEAQQELGDTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNENRENASSNHDHDDGASGTPKEKKAKTSKKK
Specificity
Specificity of human ING1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ING1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ING1 Recombinant Protein Antigen (NBP2-57223PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ING1 Antibody

  • growth inhibitor ING1
  • growth inhibitory protein ING1
  • ING1
  • inhibitor of growth family, member 1
  • inhibitor of growth protein 1
  • p24ING1c
  • p33
  • p33ING1
  • p33ING1b
  • p47
  • p47ING1a
  • tumor suppressor ING1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NCF1 Antibody
NB100-790
Western Blot: NCF1 Antibody [NB100-790] - Staining of U937 (A), Daudi (B), U251 (C) and negative control A431 (D) cell lysate (35 ug protein in RIPA buffer). Antibody at 0.2, 0.01, and 0.3 ug/mL respectively. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: NCF1 Antibody [NB100-790] - Staining of paraffin embedded Human Colon. Antibody at 5 ug/mL. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Flow Cytometry: NCF1 Antibody [NB100-790] - Analysis of paraformaldehyde fixed HeLa cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
(3 Publications)
Species: Hu, Mu, Po, Ba
Applications: WB, Flow, IHC, IHC-P, IP, PEP-ELISA, IF
Siglec-3/CD33
Antibody (44M12D3)
NBP2-22377
Western Blot: Siglec-3/CD33 Antibody (44M12D3) [NBP2-22377] - Analysis of CD33 in A) a partial recombinant protein and B) HCT-116 lysate using CD33 antibody at 2 ug/ml. goat anti-mouse Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Immunohistochemistry-Paraffin: Siglec-3/CD33 Antibody (44M12D3) [NBP2-22377] - Human lung tissue stained with CD33 antibody (3 ug/ml), peroxidase-conjugate and DAB chromogen. Note cytoplasmic and membrane staining.
(2 Publications)
Species: Hu
Applications: WB, IHC, IHC-P
Methionine
Aminopeptidase 2/META ...
NBP2-80467
Western Blot: Methionine Aminopeptidase 2/METAP2 Antibody (JG39-79) [NBP2-80467] - Analysis of Methionine Aminopeptidase 2/METAP2/METAP2 on Hela cell using anti-Methionine Aminopeptidase 2/METAP2/METAP2 antibody at 1/1,000 dilution. Positive control: Lane 1: Daudi Lane 2: K562 Lane 3: Mouse thymus Lane 4: Mouse kidney
Immunocytochemistry/Immunofluorescence: Methionine Aminopeptidase 2/METAP2 Antibody (JG39-79) [NBP2-80467] - Staining Methionine Aminopeptidase 2 in SH-SY-5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilized with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Methionine Aminopeptidase 2/METAP2 Antibody (JG39-79) [NBP2-80467] - Analysis in mouse testis tissue using Methionine Aminopeptidase 2/METAP2/METAP2 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Syntaxin-BP1
Antibody
NBP1-83139
Western Blot: Syntaxin-BP1 Antibody [NBP1-83139] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/Immunofluorescence: Syntaxin-BP1 Antibody [NBP1-83139] - Staining of human cell line SK-MEL-30 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Syntaxin-BP1 Antibody [NBP1-83139] - Staining of human liver shows no positivity in hepatocytes as expected.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
CYBB/NOX2 Antibody
(NL7)
NBP1-41012
Flow Cytometry: CYBB/NOX2 Antibody (NL7) [NBP1-41012] - Using the Alexa Fluor 647 direct conjugate An intracellular stain was performed on Daudi cells with CYBB/NOX2 (NL7) antibody NBP1-41012AF647 (blue) and a matched isotype control NBP1-97005AF647 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Flow Cytometry: CYBB/NOX2 Antibody (NL7) [NBP1-41012] - Staining of human peripheral blood granulocytes with Mouse anti Human Cytochrome b-245 Heavy Chain. Permeabilised with Leucoperm
Flow Cytometry: CYBB/NOX2 Antibody (NL7) [NBP1-41012] - Analysis using the PE conjugate of NBP1-41012. Staining of CYBB in human peripheral blood using anti-CYBB antibody. Image from verified customer review.
(2 Reviews)
(2 Publications)
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC

Calcium-binding-protei
NBP1-33736
Western Blot: Calcium-binding-protein-P22 Antibody [NBP1-33736] - A. 50 ug mouse liver lysate/extract 12 % SDS-PAGE
Immunocytochemistry/Immunofluorescence: Calcium-binding-protein-P22 Antibody [NBP1-33736] - HepG2 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Calcium binding protein P22 protein stained by Calcium binding protein P22 antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: Calcium-binding-protein-P22 Antibody [NBP1-33736] - Paraffin-embedded mouse lung. Calcium binding protein P22 antibody dilution: 1:500.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Prohibitin 2
Antibody
NBP2-13754
Western Blot: Prohibitin 2 Antibody [NBP2-13754] - Analysis in human cell line BEWO.
Immunocytochemistry/Immunofluorescence: Prohibitin 2 Antibody [NBP2-13754] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Prohibitin 2 Antibody [NBP2-13754] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
DYNC1H1 Antibody
NBP1-84254
Immunohistochemistry-Paraffin: DYNC1H1 Antibody [NBP1-84254] - Staining in human cerebral cortex and pancreas tissues using anti-DYNC1H1 antibody. Corresponding DYNC1H1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: DYNC1H1 Antibody [NBP1-84254] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: DYNC1H1 Antibody [NBP1-84254] - Staining of human pancreas shows low expression as expected.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
DCTN3 Antibody
NBP2-98673
Western Blot: DCTN3 Antibody [NBP2-98673] - Anti-DCTN3 rabbit polyclonal antibody at 1:500 dilution. Lane A: 293T Whole Cell Lysate Lane B: HeLa Whole Cell Lysate Lane C: U-251 MG Whole Cell Lysate Lysates/proteins at 30 ug per lane. Secondary Goat Anti-Rabbit IgG (H+L)/HRP at 1/10000 dilution. Developed using the ECL technique. Performed under reducing conditions. Predicted band size: 21 kDa. Observed band size: 21 kDa
Immunohistochemistry-Paraffin: DCTN3 Antibody [NBP2-98673] - Immunochemical staining of human DCTN3 in human pancreas with rabbit polyclonal antibody at 1:100 dilution, formalin-fixed paraffin embedded sections.
Immunoprecipitation: DCTN3 Antibody [NBP2-98673] - DCTN3 was immunoprecipitated using: Lane A: 0.5 mg HeLa Whole Cell Lysate 4 ul anti-DCTN3 rabbit polyclonal antibody and 60 ug of Immunomagnetic beads Protein A/G. Primary antibody: Anti-DCTN3 rabbit polyclonal antibody, at 1:100 dilution. Secondary antibody: Goat Anti-Rabbit IgG (H+L)/HRP at 1/10000 dilution. Developed using the ECL technique. Performed under reducing conditions. Predicted band size: 21 kDa. Observed band size: 21 kDa
Species: Hu
Applications: WB, IHC, IHC-P, IP
ERK2 Antibody
(191801) [Unconjugate
MAB1230
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, MCF‑7 human breast cancer cell line, U937 human histiocytic lymphoma cell line,PC‑12 rat adrenal pheochromocytoma cell line, and NIH‑3T3 mouse embryonic fibroblast cell line. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for ERK2 at approximately 44 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
ERK2 was detected in immersion fixed 3T3‑L1 mouse embryonic fibroblast adipose-like cell line using Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230) at 3 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm and nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and MCF‑7 human breast cancer cell line, loaded at 0.5 mg/mL. A specific band was detected for ERK2 at approximately 43 kDa (as indicated) using 10 µg/mL of Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - Analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - PC12 cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-p53 Antibody (PAb 240) NB200-103 at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(3 Reviews)
(28 Publications)
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1 (HJ21)) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(14 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Serum-starved MCF‑7 human breast cancer cells were unstimulated (light orange filled histogram) or activated with 100 ng/mL Recombinant human IGF-1 (Catalog # 291-G1, dark orange filled histogram) for 15 minutes, then stained with Rabbit Anti-Human/Mouse/Rat Phospho‑Akt (S473) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF887) or control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(23 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(32 Reviews)
(647 Publications)
Species: Hu
p63/TP73L Antibody
[Unconjugated]
AF1916
p63/TP73L was detected in immersion fixed paraffin-embedded sections of human breast using Goat Anti-Human p63/TP73L Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1916) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to nuclei. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
p63/TP73L was detected in immersion fixed SCC-25 human tongue carcinoma cell line using Goat Anti-Human p63/TP73L Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1916) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (yellow; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(4 Reviews)
(3 Publications)
Species: Hu
Applications: WB, IHC, ICC
GEF-H1 Antibody
NBP2-21577
Western Blot: GEF-H1 Antibody [NBP2-21577] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with GEF-H1 antibody diluted at 1:4000. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: GEF-H1 Antibody [NBP2-21577] - GEF-H1 antibody detects GEF-H1 protein at cytoskeleton and Golgi apparatus by immunofluorescent analysis. Sample: HeLa cells were fixed in ice-cold MeOH for 5 min. Green: GEF-H1 stained by GEF-H1 antibody diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar= 10 um.
Immunohistochemistry-Paraffin: GEF-H1 Antibody [NBP2-21577] - GEF-H1 antibody detects GEF-H1 protein at cytoplasm by immunohistochemical analysis. Sample: Paraffin-embedded mouse brain. GEF-H1 stained by GEF-H1 antibody diluted at 1:1000. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD
RPSA Antibody
NBP1-33002
Western Blot: RPSA Antibody [NBP1-33002] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with RPSA antibody diluted at 1:1000.
Immunohistochemistry-Paraffin: RPSA Antibody [NBP1-33002] - CA922 xenograft, using RPSA antibody at 1:500 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
Western Blot: RPSA Antibody [NBP1-33002] - Sample (50 ug of whole cell lysate) A: mouse brain 12% SDS PAGE; antibody diluted at 1:1000.
(2 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
PSMD7 Antibody
NBP2-38780
Western Blot: PSMD7 Antibody [NBP2-38780] - Analysis using Anti-PSMD7 antibody NBP2-38780 (A) shows similar pattern to independent antibody NBP2-38612 (B).
Immunocytochemistry/Immunofluorescence: PSMD7 Antibody [NBP2-38780] - Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: PSMD7 Antibody [NBP2-38780] - Staining of human kidney.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
EBNA1BP2 Antibody
NBP1-84022
Western Blot: EBNA1BP2 Antibody [NBP1-84022] - Analysis in human cell line U-251 MG.
Immunocytochemistry/Immunofluorescence: EBNA1BP2 Antibody [NBP1-84022] - Staining of human cell line A-431 shows localization to nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: EBNA1BP2 Antibody [NBP1-84022] - Staining of human oral mucosa shows strong nuclear positivity in squamous epithelial cells.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
ING1 Antibody
NBP2-57223
ING1 Antibody
Species: Hu
Applications: ICC/IF

Publications for ING1 Antibody (NBP2-57223) (0)

There are no publications for ING1 Antibody (NBP2-57223).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ING1 Antibody (NBP2-57223) (0)

There are no reviews for ING1 Antibody (NBP2-57223). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ING1 Antibody (NBP2-57223) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional ING1 Products

Bioinformatics Tool for ING1 Antibody (NBP2-57223)

Discover related pathways, diseases and genes to ING1 Antibody (NBP2-57223). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ING1 Antibody (NBP2-57223)

Discover more about diseases related to ING1 Antibody (NBP2-57223).
 

Pathways for ING1 Antibody (NBP2-57223)

View related products by pathway.

PTMs for ING1 Antibody (NBP2-57223)

Learn more about PTMs related to ING1 Antibody (NBP2-57223).
 

Research Areas for ING1 Antibody (NBP2-57223)

Find related products by research area.

Blogs on ING1.

Check out the latest blog posts on ING1.
Understanding the Reasons for Histone H3 K4 Trimethylation (H3K4Me3)
Epigenetic mechanisms allow distinction between the active and inactive compartments of the genome, allowing proper cell lineage and embryogenesis. The trimethylation of Histone 3 at lysine 4 (H3K4Me3) is a common epigenetic histone modification that...  Read full blog post.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ING1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ING1