ING1 Antibody


Immunocytochemistry/ Immunofluorescence: ING1 Antibody [NBP2-57223] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

ING1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VELFEAQQELGDTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNENRENASSNHDHDDGASGTPKEKKAKTSKKK
Specificity of human ING1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ING1 Recombinant Protein Antigen (NBP2-57223PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for ING1 Antibody

  • growth inhibitor ING1
  • growth inhibitory protein ING1
  • ING1
  • inhibitor of growth family, member 1
  • inhibitor of growth protein 1
  • p24ING1c
  • p33
  • p33ING1
  • p33ING1b
  • p47
  • p47ING1a
  • tumor suppressor ING1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Po, Ba
Applications: WB, Flow, IHC, IHC-P, IP, PEP-ELISA, IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: WB, IHC, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF

Publications for ING1 Antibody (NBP2-57223) (0)

There are no publications for ING1 Antibody (NBP2-57223).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ING1 Antibody (NBP2-57223) (0)

There are no reviews for ING1 Antibody (NBP2-57223). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ING1 Antibody (NBP2-57223) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional ING1 Products

Bioinformatics Tool for ING1 Antibody (NBP2-57223)

Discover related pathways, diseases and genes to ING1 Antibody (NBP2-57223). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ING1 Antibody (NBP2-57223)

Discover more about diseases related to ING1 Antibody (NBP2-57223).

Pathways for ING1 Antibody (NBP2-57223)

View related products by pathway.

PTMs for ING1 Antibody (NBP2-57223)

Learn more about PTMs related to ING1 Antibody (NBP2-57223).

Research Areas for ING1 Antibody (NBP2-57223)

Find related products by research area.

Blogs on ING1.

Understanding the Reasons for Histone H3 K4 Trimethylation (H3K4Me3)
Epigenetic mechanisms allow distinction between the active and inactive compartments of the genome, allowing proper cell lineage and embryogenesis. The trimethylation of Histone 3 at lysine 4 (H3K4Me3) is a common epigenetic histone modification that...  Read full blog post.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ING1 Antibody and receive a gift card or discount.


Gene Symbol ING1