ING1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ING1 Antibody [NBP2-57223] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ING1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VELFEAQQELGDTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNENRENASSNHDHDDGASGTPKEKKAKTSKKK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ING1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ING1 Recombinant Protein Antigen (NBP2-57223PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ING1 Antibody - BSA Free

• growth inhibitor ING1
• growth inhibitory protein ING1
• ING1
• inhibitor of growth family, member 1
• inhibitor of growth protein 1
• p24ING1c
• p33
• p33ING1
• p33ING1b
• p47
• p47ING1a
• tumor suppressor ING1

Background

p33 ING1 is a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53-signaling pathway. Reduced expression and rearrangement of this gene have been detected in various cancers. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported. The accession number listed below is for variant (4) that encodes the longest isoform (D). Other synonyms for p33 ING1 include p33, p47, p33ING1, p24ING1c, p33ING1b, p47ING1a, growth inhibitor ING1, inhibitor of growth 1, tumor suppressor ING1 and growth inhibitory protein ING1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ING1