INF2 Antibody - BSA Free

Immunohistochemistry-Paraffin: INF2 Antibody [NBP1-88414] - Staining of human kidney shows moderate to strong cytoplasmic positivity in podocytes.

Immunohistochemistry-Paraffin: INF2 Antibody [NBP1-88414] - Staining of human stomach shows moderate to strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: INF2 Antibody [NBP1-88414] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.

Staining of human skeletal muscle shows no cytoplasmic positivity in striated muscle fibers.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

INF2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit INF2 Antibody - BSA Free (NBP1-88414) is a polyclonal antibody validated for use in IHC. Anti-INF2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GVARISDALLQLTCVSCVRAVMNSRQGIEYILSNQGYVRQLSQALDTSNVMVKKQVFELLAALCIYSPEGHVLTLDALDHYKTVCSQQYRFSIVMNELSGSDNVPYVVTLLSVINAVILGPEDLRARTQLRNEFIGLQLLDVLAR
• Predicted Species: Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: INF2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: IHC reported in scientific literature (PMID: 26086034). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  INF2 Protein (NBP1-88414PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 26086034).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for INF2 Antibody - BSA Free

• C14orf151
• C14orf173DKFZp762A0214
• chromosome 14 open reading frame 151
• chromosome 14 open reading frame 173
• FLJ22056
• FSGS5
• HBEAG-binding protein 2 binding protein C
• HBEBP2-binding protein C
• inverted formin, FH2 and WH2 domain containing
• inverted formin-2
• MGC13251
• pp9484

Background

Actin filaments grow only when actin monomers have access to the fast-growing barbed end of the filament. The geometry of the filament network depends on the actions of the ARP2/3 complex (MIM 604221) and members of the formin family, such as INF2. The ARP2/3 complex binds to the sides of preexisting filaments and nucleates filaments whose barbed ends are quickly blocked by capping proteins, producing brush-like structures, such as those found at the leading edges of crawling cells. In contrast, formins bind to the barbed ends of growing filaments and protect them from capping, creating long filaments that can be cross-linked into bundles, such as those found in actin cables of yeast. Interaction of formins with actin barbed ends occurs through the formin homology-2 (FH2) domain. FH2 domains accelerate filament nucleation, move with the barbed end as the filament grows, and block capping of the barbed end by proteins such as gelsolin (GSN; MIM 137350). The FH1 domain of formins binds to profilin (see MIM 176610) and accelerates elongation from the FH2-bound barbed ends (Bindschadler and McGrath, 2004 [PubMed 15466701]; Chhabra and Higgs, 2006 [PubMed 16818491]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for INF2 Antibody (NBP1-88414)(1)

Publication using NBP1-88414

• Sun H, Al-Romaih KI, MacRae CA et al. Human Kidney Disease-causing INF2 Mutations Perturb Rho/Dia Signaling in the Glomerulus. EBioMedicine 2014-12-01 [PMID: 26086034] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: INF2