INF2 Antibody

Images

 
Immunohistochemistry-Paraffin: INF2 Antibody [NBP1-88414] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: INF2 Antibody [NBP1-88414] - Staining of human kidney shows moderate cytoplasmic positivity in podocytes, as well as moderate cytoplasmic positivity in a subset of tubules.
Immunohistochemistry-Paraffin: INF2 Antibody [NBP1-88414] - Staining of human stomach shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: INF2 Antibody [NBP1-88414] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

INF2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GVARISDALLQLTCVSCVRAVMNSRQGIEYILSNQGYVRQLSQALDTSNVMVKKQVFELLAALCIYSPEGHVLTLDALDHYKTVCSQQYRFSIVMNELSGSDNVPYVVTLLSVINAVILGPEDLRARTQLRNEFIGLQLLDVLAR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
INF2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
INF2 Protein (NBP1-88414PEP)
Publications
Read Publication using
NBP1-88414 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 26086034).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for INF2 Antibody

  • C14orf151
  • C14orf173DKFZp762A0214
  • chromosome 14 open reading frame 151
  • chromosome 14 open reading frame 173
  • FLJ22056
  • FSGS5
  • HBEAG-binding protein 2 binding protein C
  • HBEBP2-binding protein C
  • inverted formin, FH2 and WH2 domain containing
  • inverted formin-2
  • MGC13251
  • pp9484

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89818
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
AF3159
Species: Mu
Applications: WB, IHC
NBP2-24615
Species: Hu
Applications: WB, IHC-P
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-22522
Species: Hu, Mu, Rt, Xp
Applications: WB
H00081624-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB600-230
Species: Hu
Applications: WB
NBP1-00142
Species: Hu, Mu
Applications: WB, IP, PEP-ELISA
NB100-2307
Species: Hu
Applications: WB
NBL1-12830
Species: Hu
NBP1-06529
Species: Hu
Applications: WB, IHC-P, IP, PLA
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88498
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81610
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88414
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for INF2 Antibody (NBP1-88414)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for INF2 Antibody (NBP1-88414) (0)

There are no reviews for INF2 Antibody (NBP1-88414). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for INF2 Antibody (NBP1-88414) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional INF2 Products

Bioinformatics Tool for INF2 Antibody (NBP1-88414)

Discover related pathways, diseases and genes to INF2 Antibody (NBP1-88414). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for INF2 Antibody (NBP1-88414)

Discover more about diseases related to INF2 Antibody (NBP1-88414).
 

Pathways for INF2 Antibody (NBP1-88414)

View related products by pathway.

PTMs for INF2 Antibody (NBP1-88414)

Learn more about PTMs related to INF2 Antibody (NBP1-88414).

Blogs on INF2

There are no specific blogs for INF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our INF2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol INF2