Indian Hedgehog/Ihh Antibody (2G9)

Images

 
Western Blot: Indian Hedgehog/Ihh Antibody (2G9) [H00003549-M01] - IHH monoclonal antibody (M01), clone 2G9 Analysis of IHH expression in Jurkat.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2G9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Indian Hedgehog/Ihh Antibody (2G9) Summary

Immunogen
IHH (AAH34757 119 a.a. - 217 a.a.) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ESGARVALSAVRPGDRVLAMGEDGSPTFSDVLIFLDREPHRLRAFQVIETQDPPRRLALTPAHLLFTADNHTEPAARFRATFASHVQPGQYVLVAGVPG
Specificity
IHH (2G9)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
IHH
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate for WB. It has been used for ELISA.
Publications
Read Publication using H00003549-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Indian Hedgehog/Ihh Antibody (2G9)

  • BDA1
  • BDA1Indian hedgehog homolog (Drosophila)
  • HHG2
  • HHG-2
  • Ihh
  • Indian hedgehog (Drosophila) homolog
  • Indian hedgehog homolog
  • indian hedgehog protein
  • Indian Hedgehog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47945
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
NBP1-57016
Species: Hu
Applications: WB
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF196
Species: Mu
Applications: WB, IHC
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC-P
355-BM/CF
Species: Hu, Mu, Rt
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
AF3075
Species: Hu
Applications: WB, ICC
NBP2-23602
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
AF3690
Species: Hu, Mu
Applications: WB, ChIP, ICC

Publications for Indian Hedgehog/Ihh Antibody (H00003549-M01)(1)


Reviews for Indian Hedgehog/Ihh Antibody (H00003549-M01) (0)

There are no reviews for Indian Hedgehog/Ihh Antibody (H00003549-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Indian Hedgehog/Ihh Antibody (H00003549-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Indian Hedgehog/Ihh Products

Bioinformatics Tool for Indian Hedgehog/Ihh Antibody (H00003549-M01)

Discover related pathways, diseases and genes to Indian Hedgehog/Ihh Antibody (H00003549-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Indian Hedgehog/Ihh Antibody (H00003549-M01)

Discover more about diseases related to Indian Hedgehog/Ihh Antibody (H00003549-M01).
 

Pathways for Indian Hedgehog/Ihh Antibody (H00003549-M01)

View related products by pathway.

PTMs for Indian Hedgehog/Ihh Antibody (H00003549-M01)

Learn more about PTMs related to Indian Hedgehog/Ihh Antibody (H00003549-M01).
 

Research Areas for Indian Hedgehog/Ihh Antibody (H00003549-M01)

Find related products by research area.

Blogs on Indian Hedgehog/Ihh

There are no specific blogs for Indian Hedgehog/Ihh, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Indian Hedgehog/Ihh Antibody (2G9) and receive a gift card or discount.

Bioinformatics

Gene Symbol IHH
Entrez
OMIM
Uniprot