Indian Hedgehog/Ihh Antibody (2G9) - Azide and BSA Free Summary
| Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen |
IHH (AAH34757, 119 a.a. ~ 217 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ESGARVALSAVRPGDRVLAMGEDGSPTFSDVLIFLDREPHRLRAFQVIETQDPPRRLALTPAHLLFTADNHTEPAARFRATFASHVQPGQYVLVAGVPG |
| Specificity |
IHH (2G9) |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
IHH |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody reactivity against cell lysate for WB. It has been used for ELISA. |
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Indian Hedgehog/Ihh Antibody (2G9) - Azide and BSA Free
Background
Hedgehog, WNT, FGF and BMP signaling pathways network together during embryogenesis, tissue regeneration, and carcinogenesis. Aberrant activation of Hedgehog signaling pathway leads to pathological consequences in a variety of human tumors, such as gastric cancer and pancreatic cancer (1). The hedgehog family of morphogens are regulators of cell proliferation, differentiation and cell-cell communication. These morphogens have been shown to have important roles in organogenesis, spermatogenesis, stem cell maintenance and oncogenesis. Indian hedgehog (IHH) has been shown to be expressed in the uterine epithelium under the control of the steroid hormone, progesterone (2). It has been shown that IHH, synthesized by prehypertrophic and hypertrophic chondrocytes, regulates the site of hypertrophic differentiation by signaling to the periarticular growth plate and also determines the site of bone collar formation in the adjacent perichondrium. By providing crucial local signals from prehypertrophic and hypertrophic chondrocytes to both chondrocytes and preosteoblasts, IHH couples chondrogenesis to osteogenesis in endochondral bone development (3).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: BA
Species: Hu
Applications: IHC
Species: Hu, Mu
Applications: WB
Species: Ca, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, IB, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ICC
Species: Mu
Applications: IHC, WB
Species: Bt, Bv, Ca, Eq, Ha, Hu, Pm, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: BA, BA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC, Simple Western, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu
Applications: ChIP, ICC, WB
Species: Hu
Applications: WB, ELISA
Publications for Indian Hedgehog/Ihh Antibody (H00003549-M01)(1)
Showing Publication 1 -
1 of 1.
Reviews for Indian Hedgehog/Ihh Antibody (H00003549-M01) (0)
There are no reviews for Indian Hedgehog/Ihh Antibody (H00003549-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Indian Hedgehog/Ihh Antibody (H00003549-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Indian Hedgehog/Ihh Products
Research Areas for Indian Hedgehog/Ihh Antibody (H00003549-M01)
Find related products by research area.
|
Blogs on Indian Hedgehog/Ihh