INCA Antibody

Images

 
Western Blot: INCA Antibody [NBP1-74090] - Jurkat Cell Lysate, Antibody Titration: 1 ug/ml, and Gel concentration: 10-20%

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

INCA Antibody Summary

Immunogen
Synthetic peptides corresponding to the middle region of CARD17. Immunizing peptide sequence MDKARALLDSVIRKGAPACQICITYICEEDSHLAGTLGLSAGPTSGNHLT.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CARD17
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CARD17 and was validated on Western blot.
Theoretical MW
12 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for INCA Antibody

  • caspase recruitment domain family, member 17
  • caspase recruitment domain-containing protein 17
  • Caspase-1 inhibitor INCA
  • INCAInhibitory CARD
  • inhibitory caspase recruitment domain (CARD) protein
  • Inhibitory caspase recruitment domain protein

Background

As a regulator of procaspase-1/CASP1 activation, CARD17 is implicated in the regulation of the proteolytic maturation of pro-IL-1beta/IL1B and its release during inflammation. CARD17 inhibits the release of IL1B in response to LPS in monocytes. However, unlike CASP1, CARD17 do not induce NF-kappa-B activation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-57614
Species: Hu
Applications: ICC/IF
NBP1-59448
Species: Hu
Applications: WB
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-48688
Species: Hu
Applications: IHC
NBP2-59320
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC
H00114769-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-39027
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-80104
Species: Hu
Applications: WB
NBP1-83192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56565
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-89705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-26612
Species: Hu
Applications: IP (-), WB

Publications for INCA Antibody (NBP1-74090) (0)

There are no publications for INCA Antibody (NBP1-74090).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for INCA Antibody (NBP1-74090) (0)

There are no reviews for INCA Antibody (NBP1-74090). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for INCA Antibody (NBP1-74090) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional INCA Products

Bioinformatics Tool for INCA Antibody (NBP1-74090)

Discover related pathways, diseases and genes to INCA Antibody (NBP1-74090). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for INCA Antibody (NBP1-74090)

Find related products by research area.

Blogs on INCA

There are no specific blogs for INCA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our INCA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CARD17
Uniprot