alpha COP I Antibody

Images

 
Western Blot: alpha COP I Antibody [NBP1-89705] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: alpha COP I Antibody [NBP1-89705] - Staining of human cell line A-431 shows positivity in cytoplasm, intermediate filaments & nucleus but excluded from the nucleoli. Antibody ...read more
Immunohistochemistry-Paraffin: alpha COP I Antibody [NBP1-89705] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.
Western Blot: alpha COP I Antibody [NBP1-89705] - Analysis in human cell line RT-4.
Immunohistochemistry-Paraffin: alpha COP I Antibody [NBP1-89705] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: alpha COP I Antibody [NBP1-89705] - Staining of human pancreas shows strong positivity.
Immunohistochemistry-Paraffin: alpha COP I Antibody [NBP1-89705] - Staining of human stomach shows moderate granular cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

alpha COP I Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VHGNMLHYVKDRFLRQLDFNSSKDVAVMQLRSGSKFPVFNMSYNPAENAVLLCTRASNLENSTYDLYTIPKDADSQNPDAPEGKRSSGLTAVWVARN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COPA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
alpha COP I Protein (NBP1-89705PEP)
Publications
Read Publication using
NBP1-89705 in the following applications:

  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25894502).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for alpha COP I Antibody

  • alpha coat protein
  • Alpha-coat protein
  • Alpha-COP
  • coatomer protein complex, subunit alpha
  • coatomer subunit alpha
  • FLJ26320
  • HEPCOP
  • HEP-COPalpha-COP
  • xenin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NBP2-15578
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-46198
Species: Hu
Applications: IHC, WB
NBP2-20231
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-65315
Species: Bv, Ca, Eq, Gt, Sh
Applications: Flow, IHC, IHC-Fr, IP
MAB8864
Species: Hu
Applications: IHC
NBP2-92058
Species: Hu, Mu
Applications: ICC/IF, WB
NB100-856
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
NBP1-00154
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
NBP2-38512
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB400-152
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
1310-SE
Species: Hu
Applications: EnzAct
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP2-55178
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-46258
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-88899
Species: Hu
Applications: IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-89705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for alpha COP I Antibody (NBP1-89705)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for alpha COP I Antibody (NBP1-89705) (0)

There are no reviews for alpha COP I Antibody (NBP1-89705). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for alpha COP I Antibody (NBP1-89705) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional alpha COP I Products

Bioinformatics Tool for alpha COP I Antibody (NBP1-89705)

Discover related pathways, diseases and genes to alpha COP I Antibody (NBP1-89705). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for alpha COP I Antibody (NBP1-89705)

Discover more about diseases related to alpha COP I Antibody (NBP1-89705).
 

Pathways for alpha COP I Antibody (NBP1-89705)

View related products by pathway.

PTMs for alpha COP I Antibody (NBP1-89705)

Learn more about PTMs related to alpha COP I Antibody (NBP1-89705).
 

Research Areas for alpha COP I Antibody (NBP1-89705)

Find related products by research area.

Blogs on alpha COP I

There are no specific blogs for alpha COP I, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our alpha COP I Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COPA