alpha COP I Antibody - BSA Free

Staining of human cell line A-431 shows positivity in cytoplasm, intermediate filaments & nucleus but excluded from the nucleoli.

Immunohistochemistry-Paraffin: alpha COP I Antibody [NBP1-89705] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: alpha COP I Antibody [NBP1-89705] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: alpha COP I Antibody [NBP1-89705] - Staining of human stomach shows moderate granular cytoplasmic positivity in glandular cells.

Staining of human pancreas shows moderate to strong granular cytoplasmic positivity in exocrine glandular cells.

Analysis in human cell line RT-4.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

alpha COP I Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit alpha COP I Antibody - BSA Free (NBP1-89705) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-alpha COP I Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VHGNMLHYVKDRFLRQLDFNSSKDVAVMQLRSGSKFPVFNMSYNPAENAVLLCTRASNLENSTYDLYTIPKDADSQNPDAPEGKRSSGLTAVWVARN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: COPA
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  alpha COP I Protein (NBP1-89705PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25894502).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for alpha COP I Antibody - BSA Free

• alpha coat protein
• Alpha-coat protein
• Alpha-COP
• coatomer protein complex, subunit alpha
• coatomer subunit alpha
• FLJ26320
• HEPCOP
• HEP-COPalpha-COP
• xenin

Background

Coatomer proteins are involved in regulating transport between the endoplasmic reticulum (ER) and the Golgi complex and in intra-Golgi transport. There exist two coatomer-protein mechanisms (COP I and COP II) and although they have mechanistic parallels, they are molecularly distinct. The COP I coat is comprised of seven subunits (alpha-, beta-, beta'-, gamma-, delta-, epsilon-, and zeta-COP) in a complex called coatomer. Assembly of the coatomer (COP I) onto non-clathrin coated vesicles is regulated by ADP-ribosylation factor (ARF). Vesicle formation, budding, fusion, and disassembly is dependent on GDP-GTP exchange, COP I, and ARF. COP I has been shown to facilitate retrograde intracellular transport from the ER to the Golgi complex. By contrast, COPII facilitates anterograde transport between these subcellular organelles. COP II has been shown to be independently and selectively recruited to the ER relative to COP I subunits.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for alpha COP I Antibody (NBP1-89705)(1)

Publication using NBP1-89705

• Levi B Watkin, Birthe Jessen, Wojciech Wiszniewski et al. COPA mutations impair ER-Golgi transport and cause hereditary autoimmune-mediated lung disease and arthritis. Nature Genetics 2015-04-20 [PMID: 25894502] (WB, Human)

Bioinformatics

• Gene Symbol: COPA